KEGG   Homo sapiens (human): 1666Help
Entry
1666              CDS       T01001                                 

Gene name
DECR1, DECR, NADPH, SDR18C1
Definition
2,4-dienoyl CoA reductase 1, mitochondrial (EC:1.3.1.34)
Orthology
K13236  
2,4-dienoyl-CoA reductase, mitochondrial [EC:1.3.1.34]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.34  2,4-dienoyl-CoA reductase (NADPH)
     1666 (DECR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q21.3
AA seq 335 aa AA seqDB search
MKLPARVFFTLGSRLPCGLAPRRFFSYGTKILYQNTEALQSKFFSPLQKAMLPPNSFQGK
VAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRD
PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIG
KQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQP
GPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFD
GGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaagctaccggccagggttttctttactctggggtcccggctgccctgtggcctcgct
cctcggaggtttttcagttatgggacaaaaatattatatcaaaacactgaagctttgcaa
tctaaattcttttcacctcttcaaaaagcgatgctaccacctaatagttttcaaggaaaa
gtggcattcattactgggggaggtactggccttggtaaaggaatgacaactcttctgtcc
agcctaggtgctcagtgcgtgatagccagccggaagatggatgttttgaaagctaccgca
gaacaaatttcttctcaaactggaaataaggttcatgcaattcagtgtgatgtgagggat
cctgatatggttcaaaacactgtgtcagaactgatcaaagttgcaggacatcctaatatt
gtgataaacaatgcagcagggaattttatttctcctactgaaagactttctcctaatgct
tggaaaaccataactgacatagttctaaatggcacagccttcgtgacactagaaattgga
aaacaactaattaaagcacagaaaggagcagcatttctttctattactactatctatgct
gagactggttcaggttttgtagtaccaagtgcttctgccaaagcaggtgtggaagccatg
agcaagtctcttgcagctgaatggggtaaatatggaatgcgattcaatgtgattcaacca
gggcctataaaaaccaaaggtgcctttagccgtctggacccaactggaacatttgagaaa
gaaatgattggcagaattccctgtggtcgcctggggactgtagaagaactcgcaaatctt
gctgctttcctttgtagtgattatgcttcttggattaatggagcagtcattaaatttgac
ggtggagaggaagtacttatttcaggggaattcaacgacctgagaaaggtcaccaaggag
cagtgggacaccatagaagaactcatcaggaagacaaaaggttcctaa

DBGET integrated database retrieval system