KEGG   Homo sapiens (human): 1738Help
Entry
1738              CDS       T01001                                 

Gene name
DLD, DLDD, DLDH, E3, GCSL, LAD, PHE3
Definition
dihydrolipoamide dehydrogenase (EC:1.8.1.4)
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Pyruvate oxidation, pyruvate => acetyl-CoA
Disease
H00072  
Pyruvate dehydrogenase complex deficiency
H00172  
Maple syrup urine disease (MSUD)
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hsa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hsa00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31-q32
AA seq 509 aa AA seqDB search
MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
DKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKSINF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcagagctggagtcgtgtgtactgctccttggccaagagaggccatttcaatcgaata
tctcatggcctacagggactttctgcagtgcctctgagaacttacgcagatcagccgatt
gatgctgatgtaacagttataggttctggtcctggaggatatgttgctgctattaaagct
gcccagttaggcttcaagacagtctgcattgagaaaaatgaaacacttggtggaacatgc
ttgaatgttggttgtattccttctaaggctttattgaacaactctcattattaccatatg
gcccatggaaaagattttgcatctagaggaattgaaatgtccgaagttcgcttgaattta
gacaagatgatggagcagaagagtactgcagtaaaagctttaacaggtggaattgcccac
ttattcaaacagaataaggttgttcatgtcaatggatatggaaagataactggcaaaaat
caagtcactgctacgaaagctgatggcggcactcaggttattgatacaaagaacattctt
atagccacgggttcagaagttactccttttcctggaatcacgatagatgaagatacaata
gtgtcatctacaggtgctttatctttaaaaaaagttccagaaaagatggttgttattggt
gcaggagtaataggtgtagaattgggttcagtttggcaaagacttggtgcagatgtgaca
gcagttgaatttttaggtcatgtaggtggagttggaattgatatggagatatctaaaaac
tttcaacgcatccttcaaaaacaggggtttaaatttaaattgaatacaaaggttactggt
gctaccaagaagtcagatggaaaaattgatgtttctattgaagctgcttctggtggtaaa
gctgaagttatcacttgtgatgtactcttggtttgcattggccgacgaccctttactaag
aatttgggactagaagagctgggaattgaactagatcccagaggtagaattccagtcaat
accagatttcaaactaaaattccaaatatctatgccattggtgatgtagttgctggtcca
atgctggctcacaaagcagaggatgaaggcattatctgtgttgaaggaatggctggtggt
gctgtgcacattgactacaattgtgtgccatcagtgatttacacacaccctgaagttgct
tgggttggcaaatcagaagagcagttgaaagaagagggtattgagtacaaagttgggaaa
ttcccatttgctgctaacagcagagctaagacaaatgctgacacagatggcatggtgaag
atccttgggcagaaatcgacagacagagtactgggagcacatattcttggaccaggtgct
ggagaaatggtaaatgaagctgctcttgctttggaatatggagcatcctgtgaagatata
gctagagtctgtcatgcacatccgaccttatcagaagcttttagagaagcaaatcttgct
gcgtcatttggcaaatcaatcaacttttga

DBGET integrated database retrieval system