KEGG   Homo sapiens (human): 1767Help
Entry
1767              CDS       T01001                                 

Gene name
DNAH5, CILD3, DNAHC5, HL1, KTGNR, PCD
Definition
dynein, axonemal, heavy chain 5
Organism
hsa  Homo sapiens (human)
Disease
H00564  
Primary ciliary dyskinesia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15.2
AA seq 4624 aa AA seqDB search
MFRIGRRQLWKHSVTRVLTQRLKGEKEAKRALLDARHNYLFAIVASCLDLNKTEVEDAIL
EGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGND
VALTGVCVFFIRTDPSKAITPDNIHQEVSFNMLDAADGGLLNSVRRLLSDIFIPALRATS
HGWGELEGLQDAANIRQEFLSSLEGFVNVLSGAQESLKEKVNLRKCDILELKTLKEPTDY
LTLANNPETLGKIEDCMKVWIKQTEQVLAENNQLLKEADDVGPRAELEHWKKRLSKFNYL
LEQLKSPDVKAVLAVLAAAKSKLLKTWREMDIRITDATNEAKDNVKYLYTLEKCCDPLYS
SDPLSMMDAIPTLINAIKMIYSISHYYNTSEKITSLFVKVTNQIISACKAYITNNGTASI
WNQPQDVVEEKILSAIKLKQEYQLCFHKTKQKLKQNPNAKQFDFSEMYIFGKFETFHRRL
AKIIDIFTTLKTYSVLQDSTIEGLEDMATKYQGIVATIKKKEYNFLDQRKMDFDQDYEEF
CKQTNDLHNELRKFMDVTFAKIQNTNQALRMLKKFERLNIPNLGIDDKYQLILENYGADI
DMISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRIQQPMQLFQQHPAVLSTAEAKPII
RSYNRMAKVLLEFEVLFHRAWLRQIEEIHVGLEASLLVKAPGTGELFVNFDPQILILFRE
TECMAQMGLEVSPLATSLFQKRDRYKRNFSNMKMMLAEYQRVKSKIPAAIEQLIVPHLAK
VDEALQPGLAALTWTSLNIEAYLENTFAKIKDLELLLDRVNDLIEFRIDAILEEMSSTPL
CQLPQEEPLTCEEFLQMTKDLCVNGAQILHFKSSLVEEAVNELVNMLLDVEVLSEEESEK
ISNENSVNYKNESSAKREEGNFDTLTSSINARANALLLTTVTRKKKETEMLGEEARELLS
HFNHQNMDALLKVTRNTLEAIRKRIHSSHTINFRDSNSASNMKQNSLPIFRASVTLAIPN
IVMAPALEDVQQTLNKAVECIISVPKGVRQWSSELLSKKKIQERKMAALQSNEDSDSDVE
MGENELQDTLEIASVNLPIPVQTKNYYKNVSENKEIVKLVSVLSTIINSTKKEVITSMDC
FKRYNHIWQKGKEEAIKTFITQSPLLSEFESQILYFQNLEQEINAEPEYVCVGSIALYTA
DLKFALTAETKAWMVVIGRHCNKKYRSEMENIFMLIEEFNKKLNRPIKDLDDIRIAMAAL
KEIREEQISIDFQVGPIEESYALLNRYGLLIAREEIDKVDTLHYAWEKLLARAGEVQNKL
VSLQPSFKKELISAVEVFLQDCHQFYLDYDLNGPMASGLKPQEASDRLIMFQNQFDNIYR
KYITYTGGEELFGLPATQYPQLLEIKKQLNLLQKIYTLYNSVIETVNSYYDILWSEVNIE
KINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERIT
TLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTF
TFGSFKTRGELLLRGDSTSEIIANMEDSLMLLGSLLSNRYNMPFKAQIQKWVQYLSNSTD
IIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCV
GDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQA
HLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSL
HLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTN
QAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQC
RFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAG
PAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLP
VLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKIN
FRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILS
VLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYP
ELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMT
DCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGP
VDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSS
SILDWSPILEGFLKKRSPQEAEILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSIN
MLQGLIPLKEQGGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPP
PAGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIA
KQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRM
GTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDI
QFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVR
DSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLK
LWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDCGIDTYFVDFLRDAPE
AAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVK
ISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTRSYNTSNLMEDLKVLYR
TAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEF
PRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKD
ALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLS
FIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADM
VLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQT
IRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAG
NFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSIN
KEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAE
RCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRD
LLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRY
PLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPAL
DNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTM
KGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDES
LIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMY
QTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLT
LKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLD
QISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSM
GEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQE
VHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPI
TLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRK
FGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTIRYMIGEIQYGGRVTDDYD
KRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNA
DITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERL
QKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARI
PAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEIT
RANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVL
FELMPVIRIYAENNTLRDPRFYSCPIYKKPVRTDLNYIAAVDLRTAQTPEHWVLRGVALL
CDVK
NT seq 13875 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggattgggaggagacagctctggaagcatagcgtcactcgagttttaacgcaa
agactgaagggagagaaggaagccaagcgggctcttttggatgcgaggcataactactta
tttgcaattgtggcttcctgtttggacctgaacaaaaccgaagtggaggatgccattctt
gaagggaatcagattgaaagaattgatcaactttttgctgttggaggtctccgacacctc
atgttttactatcaagatgtggaggaagcagaaacaggacaacttggctctctaggaggg
gtaaatcttgtttctggaaagattaaaaaacctaaggtgttcgtgaccgagggaaacgat
gtggctcttactggggtatgtgtgttcttcatcaggactgacccttccaaagccatcacc
cctgacaacatccaccaggaggtgagttttaacatgttagatgcggcagatggaggcctg
ctcaacagtgtgagacgtttgctgtcggacatcttcattcctgctctcagagccacgagc
catggctggggcgagctcgagggccttcaggacgcagctaacattcgccaggagttcttg
agctccctggaaggctttgtgaacgtcctgtcgggtgcacaggagagtctgaaggagaag
gtgaaccttcgaaagtgtgacatacttgaactgaaaaccctaaaggaacctacggactac
ttgactctagcaaataaccctgagactttgggaaaaatagaggattgcatgaaagtatgg
atcaaacagacagaacaggttcttgctgaaaacaatcagctgctgaaggaagcggatgac
gttgggccacgagcggagctggagcactggaaaaaaagactctccaagtttaactacctt
ttggaacaattgaaaagcccggatgtgaaggctgtgctggcagtgcttgcggcggccaag
tcgaaactgctgaagacttggcgggagatggatattcgaatcactgatgcaactaatgaa
gcaaaggacaatgtgaaatacttgtatacacttgaaaaatgttgtgaccctttgtacagc
agtgatcccctatccatgatggatgctattcctacacttataaatgcaattaaaatgatc
tatagtatctctcattactataatacctctgagaagatcacatctctgtttgtaaaggtg
acaaatcagattatatctgcatgtaaagcctatattaccaataatggaaccgcttccatc
tggaaccagccacaggatgttgttgaagaaaaaatactatctgcgattaaactgaaacag
gaataccagctctgctttcacaagacaaaacaaaagcttaaacaaaatccaaatgcaaaa
caatttgattttagcgagatgtatatttttggaaaattcgaaacttttcaccgacgcctt
gccaagataatagacatctttacaaccctcaagacgtattcagtcctgcaagattccaca
attgaagggctggaagacatggccactaaataccagggcattgtggcaaccataaagaaa
aaggaatacaatttcctagaccagcggaaaatggattttgaccaagattacgaagagttt
tgcaagcagactaatgaccttcataacgagttgcggaagttcatggatgttacatttgca
aagattcaaaacacaaatcaagctctaagaatgttgaagaaatttgaaagattgaatata
cctaatcttggtattgatgacaaatatcaacttatccttgagaactatggggctgacatt
gatatgatttcaaagctgtatacaaagcagaaatacgatcctcctctggctcgaaaccag
cctcccatcgctggaaagattttgtgggcccgccagctcttccataggattcagcagccc
atgcagcttttccagcagcacccagctgtgctaagcacggcagaagccaaacctataatt
cgcagttacaacaggatggccaaggtcctcctggagtttgaggtcctcttccacagggcg
tggcttcggcaaattgaagaaattcatgtaggtcttgaggcttcattattggtgaaggct
ccaggcacaggggaattgtttgtaaactttgaccctcagatattaatcttatttagagaa
acagagtgcatggcccagatgggtctggaagtctctccactggcaacttccctcttccag
aaacgagatagatacaaaaggaacttcagtaacatgaagatgatgctagctgaatatcag
agagtgaagtcaaaaatacctgctgccattgagcaattgattgtccctcacttggccaaa
gtggatgaagctctccaacctggcttggctgcactgacctggacatcactgaatattgag
gcttatttagaaaacacttttgcaaagatcaaggacctggagttgctgcttgacagggtc
aatgatttgattgagttccgcattgatgccattctagaagaaatgagcagcacgcctctt
tgtcagcttccccaggaggagccactaacctgtgaagagtttctccaaatgacaaaggat
ctttgtgtaaatggtgcacaaatactacattttaaaagctcattagtggaggaggcagtc
aatgagcttgtaaatatgttgctggatgtggaagttttatctgaagaagaaagtgaaaaa
atatccaatgagaatagtgttaattacaaaaatgaaagttcagcaaaaagagaagaagga
aattttgacaccttgacatcatctattaatgccagggccaatgccctgcttttgacgaca
gtcacgaggaaaaagaaagaaactgagatgttaggggaagaagcccgcgagttactctct
catttcaaccatcagaacatggatgctcttctgaaagttacaaggaatacactagaggcc
attcgcaaacgtattcattcctctcacacaattaacttccgggacagtaacagtgcctct
aacatgaagcagaacagtttgcccattttccgggcaagcgtcactctggccattcccaac
atcgtcatggcccctgccctggaagatgtacagcagaccctgaacaaagccgtggagtgc
atcatcagtgtccctaagggggtcagacagtggagcagtgaactgttgtccaagaaaaag
atacaagaaagaaaaatggctgctttgcagagtaatgaagacagtgattctgatgttgaa
atgggagaaaatgaacttcaagataccttggagatagcatctgtaaatttacccattccc
gtgcaaaccaagaactattataagaatgtttctgaaaacaaagagattgtaaaattagtt
tctgtgcttagcacaattatcaactccaccaaaaaggaagttattacatccatggattgc
ttcaaacgctacaatcacatttggcaaaagggaaaagaagaagccattaagacatttatt
acacagagccccttgctttctgaatttgagtcccagattctctatttccaaaacctagag
caggaaattaatgctgagcctgaatatgtctgtgtgggttccattgctctgtacacagct
gacttgaagttcgccctgactgctgagacaaaggcctggatggttgtcattggacgccac
tgtaacaaaaaataccggagtgagatggaaaacatttttatgcttattgaagaattcaat
aagaaactaaatcgtccaattaaggacctagatgatattcggattgcaatggcagcgctg
aaagaaataagggaggagcaaatctccattgactttcaagtaggacctattgaggaatct
tatgccctgcttaacagatatggacttctgatagcaagggaagagatagacaaagttgat
acactgcactatgcttgggagaagctgctggcacgtgctggcgaagtccagaataaatta
gtctcactgcagcccagtttcaagaaagagcttattagtgctgtggaggtattcctccaa
gattgtcaccagttttatctggactatgatttgaatggtccaatggctagcggcttgaag
ccccaggaagccagtgacaggcttatcatgtttcagaatcaatttgataatatctatcgg
aaatacatcacatatactggaggagaggagctttttggcctgccagctacacagtatcct
cagcttcttgaaataaagaagcaactaaatcttctacagaaaatatatactctgtacaac
agtgtcatagaaactgtaaatagctattatgatattctttggtcagaggtgaatattgaa
aaaattaacaatgaactcttagaattccagaacagatgtcgaaagcttccccgggccttg
aaggactggcaggcttttttggacctgaagaagatcattgatgatttcagcgagtgttgc
ccgctgctggaatacatggccagtaaagccatgatggagcggcactgggaaaggataacc
accctcaccgggcacagtctggatgtggggaatgaaagctttaagttaagaaatatcatg
gaggcacctcttctgaaatataaagaggaaatagaggacatctgtatcagtgcggtgaaa
gagagagacattgagcaaaagctgaagcaagtgattaatgaatgggacaataaaacattc
accttcggcagctttaaaacccgtggagagctcctcttgagaggagacagtacctcggaa
atcatcgccaacatggaggacagcttgatgttgctgggatccctactgagcaacaggtac
aatatgccattcaaagcccagattcaaaaatgggtgcagtacctttccaactcaacagac
atcatcgagagctggatgacggtgcaaaacctgtggatttatttagaagctgtctttgtg
ggaggagacattgccaagcagctgcccaaggaagccaagcggttttctaacatagataaa
tcttgggtgaagatcatgactcgggcacatgaagtgcccagtgtagtccagtgctgtgtt
ggagatgagaccctggggcagctgttaccacacttgctggaccagttggaaatatgccag
aaatcccttactgggtacttggagaaaaaacgactgtgctttcctcggtttttcttcgtc
tcagatcctgcccttctagagattctggggcaggcgtcggactcccacactatacaggcc
catttgctgaatgtgtttgacaacattaaatctgtcaagttccacgaaaagatctatgat
cgaattctgtcaatttcctctcaagagggtgagacgattgaattggataaacctgtcatg
gcagagggcaatgtggaagtttggcttaattctcttttggaagaatctcagtcctcattg
catcttgtgattcgccaggcagccgcaaatattcaagaaacaggtttccaactaactgaa
tttctttcatccttccctgctcaggttggattattaggaattcagatgatatggacacgg
gattcagaagaagcccttagaaatgccaagtttgataaaaaaatcatgcagaaaactaat
caggctttcctggagctactcaatacattgatagacgtcaccacgagggatctgagttcc
acggaacgagtgaaatacgagactctgattactattcatgtgcaccaaagggatatcttt
gatgacctgtgtcatatgcatatcaagagtcccatggactttgagtggctgaaacagtgc
agattttactttaacgaagattctgacaagatgatgattcacatcacagatgtggcgttc
atataccagaatgaatttttaggctgcactgacaggcttgtaataactccacttacagac
agatgttacatcacgctggctcaagctctgggaatgagcatggggggagcccctgctgga
cctgcaggcacaggcaaaacagaaaccactaaagacatgggacgatgcctcgggaaatac
gtcgtggttttcaattgttcagaccagatggatttccgaggacttggacggatttttaag
ggactggcacagtctggatcctggggttgttttgatgaatttaaccgtattgatctacca
gttctctcggttgcagcccagcaaatttccattattctgacatgtaaaaaggagcacaaa
aagtcttttatctttactgatggagataatgtgactatgaaccctgaatttgggcttttc
ttaaccatgaatcctggctatgccggacggcaggaactccctgaaaacttgaagattaat
ttccgctcagtggccatgatggtgcctgaccgtcagattatcataagggtgaagttggct
agttgtggcttcattgacaacgttgttttggccaggaagtttttcacgctctacaaactg
tgtgaggagcagctttctaagcaggttcattatgactttggcctgcgtaacattctgtca
gttcttcggaccttgggagcagcaaaaagagccaatccaatggatacggagtccacgatt
gtcatgcgtgtactacgggacatgaatctttctaaactgattgatgaggatgaacccttg
tttttgagtttgattgaagatctctttccaaatattcttctggacaaggcaggttaccct
gaactggaagcagcaattagtagacaggttgaagaagctggtttaatcaaccatcctcct
tggaaactgaaggtcatccagctattcgaaacgcagagagtgcgacatgggatgatgact
ctggggcccagtggggctgggaagaccacctgcatccacaccttgatgagagccatgaca
gattgtggaaaaccacatcgggaaatgaggatgaatcccaaagcgattactgccccacag
atgtttggtcggctggacgttgccacaaatgactggactgatgggatattttctacgctt
tggaggaaaacattaagagcaaagaaaggggaacatatctggataattcttgatggtcca
gtagatgccatctggattgaaaatctgaattctgttttggatgataacaaaactctaacc
cttgccaatggtgatcggattcccatggctccaaactgcaagatcattttcgagcctcat
aacattgacaatgcttctcctgccaccgtctcaagaaatggaatggttttcatgagctct
tctatccttgattggagtcctattcttgagggttttcttaagaaacgctcacctcaagaa
gcagaaattcttcgtcagctgtacaccgagtctttcccagacttgtatcgcttctgtatc
cagaacttagaatacaagatggaggtgctggaggcctttgtcatcacacagagcattaac
atgcttcaaggcctgattcctctgaaggagcaaggcggggaggtgagccaggctcacctg
gggcggctgttcgtgttcgcgctgctgtggagcgcgggggcggcgctggagctggacgga
cggcgccgcctggagctctggctgcgctctcggcccacagggacgctggagctgccgccg
ccagcggggcccggggacaccgccttcgactactatgtggcgcccgatggtacatggacg
cactggaacacgcgtacccaggaatacctgtatccgtctgataccaccccagagtatggt
tctattctggtgccaaatgttgacaatgtgaggactgactttctaattcaaaccattgct
aaacagggcaaggctgtgctattaattggtgaacaaggaacagccaaaacagtaataatt
aaaggatttatgtcaaaatatgatcctgaatgtcacatgatcaagagtctgaatttttct
tctgcaaccaccccactgatgttccagaggacgatagagagctatgtggataaacgaatg
ggtacaacatatggccctcctgcgggaaagaagatgactgtttttattgatgatgtgaat
atgccaataatcaatgagtggggagatcaggttacgaatgagatagtgcgacagctgatg
gaacaaaatggattctataatctagagaagcctggggagttcaccagcatcgtggacatc
cagtttttggcagccatgatccatcctggtggtggacgcaatgacataccccaaagactc
aagaggcagttctctatatttaattgcacgttgccctctgaagcttctgtggacaagatc
tttggtgtgattggggtaggccactactgtactcagaggggtttctcagaagaagtgaga
gattctgtgacaaaattggtgcctctgacacgccgactatggcagatgaccaagattaaa
atgcttcctacccctgcaaaattccattatgtgtttaacctacgagatctttctcgggtc
tggcagggaatgctgaacactacttcagaggtcatcaaggaaccaaatgatctgttaaag
ctgtggaagcatgagtgtaaacgtgttatagctgaccgtttcacagtgtccagtgatgtg
acctggtttgataaggctttagtaagtttggtagaggaggagtttggtgaagagaaaaaa
ctcttggtggattgtggaattgacacatattttgtggatttcttgagagatgcacctgaa
gctgcaggtgaaacatctgaagaggctgatgctgaaacacctaaaatttatgagccaatt
gaatcttttagtcacctaaaagagcgtctgaatatgttcctgcagctctataatgagagc
atccgtggcgccggcatggacatggtgttctttgcagatgccatggttcacttagtcaag
atctctcgtgtcattcgtactcctcagggaaatgccctcctggtcggggtgggcggatca
ggaaagcagagcctgacgaggttggcttcattcattgctggctacgtttccttccagatc
actctgacgagatcctacaacacatcaaatctgatggaagatctgaaggttttgtatcga
acagctggtcagcaaggcaaaggaatcacttttattttcacagacaatgagattaaagat
gagtcatttttggaatatatgaacaatgttttatcatcaggtgaggtctctaacctattt
gctcgagatgaaattgatgaaattaatagcgacctggcatcagtcatgaaaaaagaattc
cccaggtgccttcctaccaatgagaacctgcacgactacttcatgagtcgggtccgacag
aaccttcatattgtgctctgcttctcgccagtgggggagaaatttcgaaacagagctttg
aagttccctgccctaatttcaggatgcacaattgactggttcagccgatggcccaaagat
gctttagttgctgtgtctgaacacttcctcacttcctatgatattgactgcagtttggaa
atcaagaaggaggtggtccaatgcatgggctccttccaggatggggtggctgagaagtgt
gttgattattttcagagattccgacgttctacccacgtgacgcccaaatcatacctctcc
tttattcagggctataagttcatatatggagaaaagcatgtggaggtgcggaccctggcc
aacagaatgaatactggattggaaaagctcaaagaagcttcagagtctgttgcagccttg
agtaaagaactggaagcgaaagaaaaggagctacaagtggccaacgataaagccgacatg
gtcttaaaagaagtgacaatgaaagcacaggctgctgaaaaggtcaaggctgaggtacag
aaggtgaaggacagggcccaggccattgtggacagcatctctaaagacaaagccattgct
gaagaaaaactggaagcagcaaaaccagctttagaagaggcagaagctgcattgcagacc
atcaggccttcggacatcgccactgttcgcacgttgggccgcccccctcacctcatcatg
cggatcatggattgcgtactgctgctgtttcaaaggaaagtcagtgctgtgaaaattgac
ctggaaaaaagctgtaccatgccctcctggcaggaatccttaaaattgatgactgcaggg
aactttttacagaacttacagcaattcccaaaagacacaatcaatgaagaggtgatagaa
tttttgagtccttactttgaaatgcctgactataacatcgaaactgctaaacgcgtatgt
ggaaatgtagctggtctttgttcctggacgaaagctatggcttccttcttttctataaac
aaagaagtactgcctctgaaggccaacttggtggtgcaagagaatcgccatctcctggcc
atgcaggatctgcagaaagcccaggccgagttggatgacaagcaggcggaacttgacgtg
gtgcaggctgagtatgaacaggccatgactgaaaagcagaccttgcttgaagatgcagag
cgatgcagacacaagatgcagacagcttccacgctcatcagtggcttggcaggtgaaaaa
gaaagatggacagagcaaagccaagagtttgctgcacaaactaaaagacttgtaggggat
gtactgttggctacagcttttctatcttattctggtccatttaaccaagagtttcgtgat
cttctgttaaatgactggcggaaggaaatgaaagcccggaaaattccatttggaaagaac
ctaaatctcagtgagatgttgattgatgctcctactattagtgaatggaacctccaaggt
ctgccaaatgatgacttgtccattcaaaatggaattattgtcacgaaggcatctcgttac
cctttgttaattgatccacagactcaaggcaagatctggattaaaaataaagaaagccga
aatgaactccagatcacgtctttaaatcacaagtacttcagaaaccacctggaagacagc
ctttctcttggaaggcctttgcttattgaagatgttggagaggaactagatccagcacta
gataatgttttggaaagaaacttcattaaaactgggtctacctttaaggtgaaagttggt
gacaaggaagtagatgtgttggatggctttagactctacattaccaccaaattgcctaac
ccagcctacacccctgagataagtgcccgtacctccatcattgacttcactgtcaccatg
aaaggtctagaagatcagttactggggagggtcattctcacagagaagcaggaattggag
aaagaaagaactcatctgatggaagatgtaactgcaaacaaaagaaggatgaaggaacta
gaagataacttgctttaccgcctgacaagtacccaggggtccctggtagaagatgaaagt
ctcattgtcgtgctgagtaacacaaaaaggacagccgaggaggtgacacagaagctagaa
atttctgctgagacagaagttcaaattaactcagcccgggaggaatacagacctgtggct
acgcggggcagcatcctctacttcctcattactgagatgcgcttggttaatgagatgtat
cagacttcgcttcgccagtttctgggcttatttgacctttccttagccaggtctgtcaag
agcccgattacaagcaagaggattgctaatatcatcgagcacatgacctacgaggtttat
aagtatgctgcccgagggctgtacgaggagcacaaattcctgttcaccttgttgcttacc
ctaaagattgacatccagaggaaccgagtcaagcatgaagagtttctcactcttattaaa
ggaggtgcctcattagaccttaaagcttgtcctccaaaaccatcaaaatggatcctggac
ataacatggctgaatttggtggaacttagcaaactcagacagttttcagatgtccttgac
cagatatcgagaaatgagaaaatgtggaaaatttggtttgataaggaaaacccggaggag
gaacctcttccaaatgcctatgataaatctcttgactgcttcagacgtcttctccttatt
agatcctggtgtcctgacagaaccatcgcccaggcccgcaagtacatcgtggactccatg
ggagaaaaatatgccgaaggtgttattttagacttggagaagacgtgggaggaatctgat
ccacggacgccactcatctgtctcctgtctatgggctcagaccccacagattccatcatt
gccttggggaagagattaaaaatagaaacccgttatgtgtccatgggccagggccaggaa
gtccatgctcggaagctcttgcagcagaccatggcgaacggaggatgggcacttctgcag
aactgccatctgggacttgatttcatggatgagctgatggacataatcatagaaactgag
cttgtacatgatgcgttccgcctctggatgaccaccgaggctcataagcagtttcccatt
acactccttcagatgtccattaaatttgccaacgatcctccacaaggactccgggcagga
ctgaaaagaacatatagtggtgtcagccaagacctgctggacgtgagctctgggtcccag
tggaagcccatgctgtacgcagtggctttcctgcactccactgtccaggagaggcgcaag
ttcggtgccctggggtggaatatcccctacgaatttaaccaagcggactttaatgccact
gtgcagttcatccaaaaccacttggatgacatggatgtcaaaaagggtgtctcctggacc
accatccgctacatgataggagagattcaatatggaggcagagtcactgacgactatgat
aagagattgttgaacacatttgctaaggtttggttcagtgaaaatatgtttggaccagat
ttcagtttttaccaaggatacaatattccaaaatgcagcacagtggataactatcttcag
tatatccagagtttgcctgcctatgacagccctgaggtgtttgggctgcaccccaatgct
gacatcacctaccagagcaagctggccaaggacgtgctggacaccatcctaggcatccaa
cccaaggacacctctggtggaggggatgagacccgggaggcggtggtggcccggctggct
gatgatatgctggagaagctgcccccagactatgtcccctttgaagtaaaagagaggctg
cagaagatggggccattccagcctatgaacattttcctcaggcaggaaatagacagaatg
caaagggtactcagccttgtccgcagcaccctcactgagctgaaacttgctattgatggc
accatcatcatgagcgaaaatctgcgagatgcattggattgcatgtttgatgctagaatc
cctgcttggtggaaaaaagcttcttggatttctagtacactgggtttctggtttactgaa
cttatagaaagaaacagccagtttacctcgtgggttttcaatggccgacctcactgcttt
tggatgacgggtttttttaacccccagggatttttaactgcaatgcgacaggaaataact
cgggccaacaaaggctgggctctggacaatatggtgctttgcaatgaagtcaccaaatgg
atgaaggacgacatttctgcccctcccacagagggtgtctatgtctatggcttatatctt
gaaggtgctggctgggacaagaggaacatgaaactcattgaatcaaagccaaaagtgctc
tttgagttgatgcctgtcataaggatttatgcagaaaacaatactttacgagatcctcgg
ttttactcctgtcccatctataagaagccagttcgaacggacttgaactacattgccgct
gtggatctcaggacagcccagacccctgaacactgggtgctccgtggggttgcccttctg
tgtgatgtcaagtaa

DBGET integrated database retrieval system