KEGG   Homo sapiens (human): 177Help
Entry
177               CDS       T01001                                 

Gene name
AGER, RAGE
Definition
advanced glycosylation end product-specific receptor
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 404 aa AA seqDB search
MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI
PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH
PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL
VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV
ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcagccggaacagcagttggagcctgggtgctggtcctcagtctgtggggggcagta
gtaggtgctcaaaacatcacagcccggattggcgagccactggtgctgaagtgtaagggg
gcccccaagaaaccaccccagcggctggaatggaaactgaacacaggccggacagaagct
tggaaggtcctgtctccccagggaggaggcccctgggacagtgtggctcgtgtccttccc
aacggctccctcttccttccggctgtcgggatccaggatgaggggattttccggtgccag
gcaatgaacaggaatggaaaggagaccaagtccaactaccgagtccgtgtctaccagatt
cctgggaagccagaaattgtagattctgcctctgaactcacggctggtgttcccaataag
gtggggacatgtgtgtcagagggaagctaccctgcagggactcttagctggcacttggat
gggaagcccctggtgcctaatgagaagggagtatctgtgaaggaacagaccaggagacac
cctgagacagggctcttcacactgcagtcggagctaatggtgaccccagcccggggagga
gatccccgtcccaccttctcctgtagcttcagcccaggccttccccgacaccgggccttg
cgcacagcccccatccagccccgtgtctgggagcctgtgcctctggaggaggtccaattg
gtggtggagccagaaggtggagcagtagctcctggtggaaccgtaaccctgacctgtgaa
gtccctgcccagccctctcctcaaatccactggatgaaggatggtgtgcccttgcccctt
ccccccagccctgtgctgatcctccctgagatagggcctcaggaccagggaacctacagc
tgtgtggccacccattccagccacgggccccaggaaagccgtgctgtcagcatcagcatc
atcgaaccaggcgaggaggggccaactgcaggctctgtgggaggatcagggctgggaact
ctagccctggccctggggatcctgggaggcctggggacagccgccctgctcattggggtc
atcttgtggcaaaggcggcaacgccgaggagaggagaggaaggccccagaaaaccaggag
gaagaggaggagcgtgcagaactgaatcagtcggaggaacctgaggcaggcgagagtagt
actggagggccttga

DBGET integrated database retrieval system