KEGG   Homo sapiens (human): 1814Help
Entry
1814              CDS       T01001                                 

Gene name
DRD3, D3DR, ETM1, FET1
Definition
dopamine receptor D3
Orthology
K04146  
dopamine receptor D3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Dopaminergic synapse
Drug target
Dopamine: 
Dopexamine: 
Levodopa: 
Pramipexole: 
Piribedil: 
Pimozide: 
Olanzapine: 
Quetiapine: 
Sulpiride: 
Levosulpiride: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1814 (DRD3)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    1814 (DRD3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Dopamine [OT]
    1814 (DRD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q13.3
AA seq 400 aa AA seqDB search
MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctgagccagctgagtggccacctgaactacacctgtggggcagagaactcc
acaggtgccagccaggcccgcccacatgcctactatgccctctcctactgcgcgctcatc
ctggccatcgtcttcggcaatggcctggtgtgcatggctgtgctgaaggagcgggccctg
cagactaccaccaactacttagtagtgagcctggctgtggcagacttgctggtggccacc
ttggtgatgccctgggtggtatacctggaggtgacaggtggagtctggaatttcagccgc
atttgctgtgatgtttttgtcaccctggatgtcatgatgtgtacagccagcatccttaat
ctctgtgccatcagcatagacaggtacactgcagtggtcatgcccgttcactaccagcat
ggcacgggacagagctcctgtcggcgcgtggccctcatgatcacggccgtctgggtactg
gcctttgctgtgtcctgccctcttctgtttggctttaataccacaggggaccccactgtc
tgctccatctccaaccctgattttgtcatctactcttcagtggtgtccttctacctgccc
tttggagtgactgtccttgtctatgccagaatctatgtggtgctgaaacaaaggagacgg
aaaaggatcctcactcgacagaacagtcagtgcaacagtgtcaggcctggcttcccccaa
caaaccctctctcctgacccggcacatctggagctgaagcgttactacagcatctgccag
gacactgccttgggtggaccaggcttccaagaaagaggaggagagttgaaaagagaggag
aagactcggaattccctgagtcccaccatagcgcccaagctcagcttagaagttcgaaaa
ctcagcaatggcagattatcgacatctttgaagctggggcccctgcaacctcggggagtg
ccacttcgggagaagaaggcaacccaaatggtggccattgtgcttggggccttcattgtc
tgctggctgcccttcttcttgacccatgttctcaatacccactgccagacatgccacgtg
tccccagagctttacagtgccacgacatggctgggctacgtgaatagcgccctcaaccct
gtgatctataccaccttcaatatcgagttccggaaagccttcctcaagatcctgtcttgc
tga

DBGET integrated database retrieval system