KEGG   Homo sapiens (human): 2067Help
Entry
2067              CDS       T01001                                 

Gene name
ERCC1, COFS4, RAD10, UV20
Definition
excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence)
Orthology
K10849  
DNA excision repair protein ERCC-1
Organism
hsa  Homo sapiens (human)
Pathway
Nucleotide excision repair
Fanconi anemia pathway
Disease
H00403  
Disorders of nucleotide excision repair
Class
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:hsa03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 273 aa AA seqDB search
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTY
AEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVP
WEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQ
ALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRSLEQLI
AASREDLALCPGLGPQKARRLFDVLHEPFLKVP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgggaaggacaaagagggggtgccccagccctcagggccgccagcaaggaag
aaatttgtgatacccctcgacgaggatgaggtccctcctggagtggccaagcccttattc
cgatctacacagagccttcccactgtggacacctcggcccaggcggcccctcagacctac
gccgaatatgccatctcacagcctctggaaggggctggggccacgtgccccacagggtca
gagcccctggcaggagagacgcccaaccaggccctgaaacccggggcaaaatccaacagc
atcattgtgagccctcggcagaggggcaatcccgtactgaagttcgtgcgcaatgtgccc
tgggaatttggcgacgtaattcccgactatgtgctgggccagagcacctgtgccctgttc
ctcagcctccgctaccacaacctgcacccagactacatccatgggcggctgcagagcctg
gggaagaacttcgccttgcgggtcctgcttgtccaggtggatgtgaaagatccccagcag
gccctcaaggagctggctaagatgtgtatcctggccgactgcacattgatcctcgcctgg
agccccgaggaagctgggcggtacctggagacctacaaggcctatgagcagaaaccagcg
gacctcctgatggagaagctagagcaggacttcgtctcccggtctctggaacagctcatc
gccgcatcaagagaagatctggccttatgcccaggcctgggccctcagaaagcccggagg
ctgtttgatgtcctgcacgagcccttcttgaaagtaccctga

DBGET integrated database retrieval system