KEGG   Homo sapiens (human): 2068Help
Entry
2068              CDS       T01001                                 

Gene name
ERCC2, COFS2, EM9, TFIIH, TTD, XPD
Definition
excision repair cross-complementation group 2 (EC:3.6.4.12)
Orthology
K10844  
DNA excision repair protein ERCC-2 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Disease
H00403  
Disorders of nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2068 (ERCC2)
  Replication and repair
   03420 Nucleotide excision repair
    2068 (ERCC2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     2068 (ERCC2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2068 (ERCC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3
AA seq 760 aa AA seqDB search
MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQ
RAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPE
VTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDL
KALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNID
NVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARE
TDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSG
LAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEP
FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMAT
FTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFT
SYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVA
RGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHA
AQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYF
LRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaacgtggacgggctcctggtctacttcccgtacgactacatctaccccgag
cagttctcctacatgcgggagctcaaacgcacgctggacgccaagggtcatggagtcctg
gagatgccctcaggcaccgggaagacagtatccctgttggccctgatcatggcataccag
agagcatatccgctggaggtgaccaaactcatctactgctcaagaactgtgccagagatt
gagaaggtgattgaagagcttcgaaagttgctcaacttctatgagaagcaggagggcgag
aagctgccgtttctgggactggctctgagctcccgcaaaaacttgtgtattcaccctgag
gtgacacccctgcgctttgggaaggacgtcgatgggaaatgccacagcctcacagcctcc
tatgtgcgggcgcagtaccagcatgacaccagcctgccccactgccgattctatgaggaa
tttgatgcccatgggcgtgaggtgcccctccccgctggcatctacaacctggatgacctg
aaggccctggggcggcgccagggctggtgcccatacttccttgctcgatactcaatcctg
catgccaatgtggtggtttatagctaccactacctcctggaccccaagattgcagacctg
gtgtccaaggaactggcccgcaaggccgtcgtggtcttcgacgaggcccacaacattgac
aacgtctgcatcgactccatgagcgtcaacctcacccgccggacccttgaccggtgccag
ggcaacctggagaccctgcagaagacggtgctcaggatcaaagagacagacgagcagcgc
ctgcgggacgagtaccggcgtctggtggaggggctgcgggaggccagcgccgcccgggag
acggacgcccacctggccaaccccgtgctgcccgacgaagtgctgcaggaggcagtgcct
ggctccatccgcacggccgagcatttcctgggcttcctgaggcggctgctggagtacgtg
aagtggcggctgcgtgtgcagcatgtggtgcaggagagcccgcccgccttcctgagcggc
ctggcccagcgcgtgtgcatccagcgcaagcccctcagattctgtgctgaacgcctccgg
tccctgctgcatactctggagatcaccgaccttgctgacttctccccgctcaccctcctt
gctaactttgccacccttgtcagcacctacgccaaaggcttcaccatcatcatcgagccc
tttgacgacagaaccccgaccattgccaaccccatcctgcacttcagctgcatggacgcc
tcgctggccatcaaacccgtatttgagcgtttccagtctgtcatcatcacatctgggaca
ctgtccccgctggacatctaccccaagatcctggacttccaccccgtcaccatggcaacc
ttcaccatgacgctggcacgggtctgcctctgccctatgatcatcggccgtggcaatgac
caggtggccatcagctccaaatttgagacccgggaggatattgctgtgatccggaactat
gggaacctcctgctggagatgtccgctgtggtccctgatggcatcgtggccttcttcacc
agctaccagtacatggagagcaccgtggcctcctggtatgagcaggggatccttgagaac
atccagaggaacaagctgctctttattgagacccaggatggtgccgaaaccagtgtcgcc
ctggagaagtaccaggaggcctgcgagaatggccgcggggccatcctgctgtcagtggcc
cggggcaaagtgtccgagggaatcgactttgtgcaccactacgggcgggccgtcatcatg
tttggcgtcccctacgtctacacacagagccgcattctcaaggcgcggctggaatacctg
cgggaccagttccagattcgtgagaatgactttcttaccttcgatgccatgcgccacgcg
gcccagtgtgtgggtcgggccatcaggggcaagacggactacggcctcatggtctttgcc
gacaagcggtttgcccgtggggacaagcgggggaagctgccccgctggatccaggagcac
ctcacagatgccaacctcaacctgaccgtggacgagggtgtccaggtggccaagtacttc
ctgcggcagatggcacagcccttccaccgggaggatcagctgggcctgtccctgctcagc
ctggagcagctagaatcagaggagacgctgaagaggatagagcagattgctcagcagctc
tga

DBGET integrated database retrieval system