KEGG   Homo sapiens (human): 211Help
Entry
211               CDS       T01001                                 

Gene name
ALAS1, ALAS, ALAS3, ALASH, MIG4
Definition
aminolevulinate, delta-, synthase 1 (EC:2.3.1.37)
Orthology
K00643  
5-aminolevulinate synthase [EC:2.3.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
Glycine, serine and threonine metabolism
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    211 (ALAS1)
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    211 (ALAS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.37  5-aminolevulinate synthase
     211 (ALAS1)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class II
   211 (ALAS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.1
AA seq 640 aa AA seqDB search
MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKE
TPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLPATSQGTASKCPFLAAQMNQRGS
SVFCKASLELQEDVQEMNAVRKEVAETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPE
RVSHLLQDNLPKSVSTFQYDRFFEKKIDEKKNDHTYRVFKTVNRRAHIFPMADDYSDSLI
TKKQVSVWCSNDYLGMSRHPRVCGAVMDTLKQHGAGAGGTRNISGTSKFHVDLERELADL
HGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRHND
VSHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVGLYG
ARGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSSLIDTVRSYAAGFIFTTSLPPM
LLAGALESVRILKSAEGRVLRRQHQRNVKLMRQMLMDAGLPVVHCPSHIIPVRVADAAKN
TEVCDELMSRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNYFLENLLVTWKQVGLE
LKPHSSAECNFCRRPLHFEVMSEREKSYFSGLSKLVSAQA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggagagtgttgttcgccgctgcccattcttatcccgagtcccccaggcctttctgcag
aaagcaggcaaatctctgttgttctatgcccaaaactgccccaagatgatggaagttggg
gccaagccagcccctcgggcattgtccactgcagcagtacactaccaacagatcaaagaa
acccctccggccagtgagaaagacaaaactgctaaggccaaggtccaacagactcctgat
ggatcccagcagagtccagatggcacacagcttccgtctggacaccccttgcctgccaca
agccagggcactgcaagcaaatgccctttcctggcagcacagatgaatcagagaggcagc
agtgtcttctgcaaagccagtcttgagcttcaggaggatgtgcaggaaatgaatgccgtg
aggaaagaggttgctgaaacctcagcaggccccagtgtggttagtgtgaaaaccgatgga
ggggatcccagtggactgctgaagaacttccaggacatcatgcaaaagcaaagaccagaa
agagtgtctcatcttcttcaagataacttgccaaaatctgtttccacttttcagtatgat
cgtttctttgagaaaaaaattgatgagaaaaagaatgaccacacctatcgagtttttaaa
actgtgaaccggcgagcacacatcttccccatggcagatgactattcagactccctcatc
accaaaaagcaagtgtcagtctggtgcagtaatgactacctaggaatgagtcgccaccca
cgggtgtgtggggcagttatggacactttgaaacaacatggtgctggggcaggtggtact
agaaatatttctggaactagtaaattccatgtggacttagagcgggagctggcagacctc
catgggaaagatgccgcactcttgttttcctcgtgctttgtggccaatgactcaaccctc
ttcaccctggctaagatgatgccaggctgtgagatttactctgattctgggaaccatgcc
tccatgatccaagggattcgaaacagccgagtgccaaagtacatcttccgccacaatgat
gtcagccacctcagagaactgctgcaaagatctgacccctcagtccccaagattgtggca
tttgaaactgtccattcaatggatggggcggtgtgcccactggaagagctgtgtgatgtg
gcccatgagtttggagcaatcaccttcgtggatgaggtccacgcagtggggctttatggg
gctcgaggcggagggattggggatcgggatggagtcatgccaaaaatggacatcatttct
ggaacacttggcaaagcctttggttgtgttggagggtacatcgccagcacgagttctctg
attgacaccgtacggtcctatgctgctggcttcatcttcaccacctctctgccacccatg
ctgctggctggagccctggagtctgtgcggatcctgaagagcgctgagggacgggtgctt
cgccgccagcaccagcgcaacgtcaaactcatgagacagatgctaatggatgccggcctc
cctgttgtccactgccccagccacatcatccctgtgcgggttgcagatgctgctaaaaac
acagaagtctgtgatgaactaatgagcagacataacatctacgtgcaagcaatcaattac
cctacggtgccccggggagaagagctcctacggattgcccccacccctcaccacacaccc
cagatgatgaactacttccttgagaatctgctagtcacatggaagcaagtggggctggaa
ctgaagcctcattcctcagctgagtgcaacttctgcaggaggccactgcattttgaagtg
atgagtgaaagagagaagtcctatttctcaggcttgagcaagttggtatctgctcaggcc
tga

DBGET integrated database retrieval system