KEGG   Homo sapiens (human): 2120Help
Entry
2120              CDS       T01001                                 

Gene name
ETV6, TEL, TEL/ABL
Definition
ets variant 6
Orthology
K03211  
ETS translocation variant 6/7
Organism
hsa  Homo sapiens (human)
Pathway
Dorso-ventral axis formation
Transcriptional misregulation in cancer
Disease
H00001  
Acute lymphoblastic leukemia (ALL) (precursor B lymphoblastic leukemia)
Class
Organismal Systems; Development; Dorso-ventral axis formation [PATH:hsa04320]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 452 aa AA seqDB search
MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIY
WSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHI
LKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH
RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPM
ENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILNPRHSVDFKQSRLSEDGLHRE
GKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRW
EDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM
KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagactcctgctcagtgtagcattaagcaggaacgaatttcatatacacctcca
gagagcccagtgccgagttacgcttcctcgacgccacttcatgttccagtgcctcgagcg
ctcaggatggaggaagactcgatccgcctgcctgcgcacctgcgcttgcagccaatttac
tggagcagggatgacgtagcccagtggctcaagtgggctgaaaatgagttttctttaagg
ccaattgacagcaacacgtttgaaatgaatggcaaagctctcctgctgctgaccaaagag
gactttcgctatcgatctcctcattcaggtgatgtgctctatgaactccttcagcatatt
ctgaagcagaggaaacctcggattcttttttcaccattcttccaccctggaaactctata
cacacacagccggaggtcatactgcatcagaaccatgaagaagataactgtgtccagagg
acccccaggccatccgtggataatgtgcaccataaccctcccaccattgaactgttgcac
cgctccaggtcacctatcacgacaaatcaccggccttctcctgaccccgagcagcggccc
ctccggtcccccctggacaacatgatccgccgcctctccccggctgagagagctcaggga
cccaggccgcaccaggagaacaaccaccaggagtcctaccctctgtcagtgtctcccatg
gagaataatcactgcccagcgtcctccgagtcccacccgaagccatccagcccccggcag
gagagcacacgcgtgatccagctgatgcccagccccatcatgcaccctctgatcctgaac
ccccggcactccgtggatttcaaacagtccaggctctccgaggacgggctgcatagggaa
gggaagcccatcaacctctctcatcgggaagacctggcttacatgaaccacatcatggtc
tctgtctccccgcctgaagagcacgccatgcccattgggagaatagcagactgtagactg
ctttgggattacgtctatcagttgctttctgacagccggtacgaaaacttcatccgatgg
gaggacaaagaatccaaaatattccggatagtggatcccaacggactggctcgactgtgg
ggaaaccataagaacagaacaaacatgacctatgagaaaatgtccagagccctgcgccac
tactacaaactaaacattatcaggaaggagccaggacaaaggcttttgttcaggtttatg
aaaaccccagatgaaatcatgagtggccgaacagaccgtctggagcacctagagtcccag
gagctggatgaacaaatataccaagaagatgaatgctga

DBGET integrated database retrieval system