KEGG   Homo sapiens (human): 2130Help
Entry
2130              CDS       T01001                                 

Gene name
EWSR1, EWS, EWS-FLI1, bK984G1.4
Definition
(RefSeq) EWS RNA binding protein 1
  KO
K13209  
RNA-binding protein EWS
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2130 (EWSR1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    2130 (EWSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q01844(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
22q12.2
AA seq 656 aa AA seqDB search
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT
YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT
QPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
MQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR
GRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDN
SAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDP
PTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGP
GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTEC
NQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFR
GGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccacggattacagtacctatagccaagctgcagcgcagcagggctacagtgct
tacaccgcccagcccactcaaggatatgcacagaccacccaggcatatgggcaacaaagc
tatggaacctatggacagcccactgatgtcagctatacccaggctcagaccactgcaacc
tatgggcagaccgcctatgcaacttcttatggacagcctcccactggttatactactcca
actgccccccaggcatacagccagcctgtccaggggtatggcactggtgcttatgatacc
accactgctacagtcaccaccacccaggcctcctatgcagctcagtctgcatatggcact
cagcctgcttatccagcctatgggcagcagccagcagccactgcacctacaagaccgcag
gatggaaacaagcccactgagactagtcaacctcaatctagcacagggggttacaaccag
cccagcctaggatatggacagagtaactacagttatccccaggtacctgggagctacccc
atgcagccagtcactgcacctccatcctaccctcctaccagctattcctctacacagccg
actagttatgatcagagcagttactctcagcagaacacctatgggcaaccgagcagctat
ggacagcagagtagctatggtcaacaaagcagctatgggcagcagcctcccactagttac
ccaccccaaactggatcctacagccaagctccaagtcaatatagccaacagagcagcagc
tacgggcagcagagttcattccgacaggaccaccccagtagcatgggtgtttatgggcag
gagtctggaggattttccggaccaggagagaaccggagcatgagtggccctgataaccgg
ggcaggggaagagggggatttgatcgtggaggcatgagcagaggtgggcggggaggagga
cgcggtggaatgggcagcgctggagagcgaggtggcttcaataagcctggtggacccatg
gatgaaggaccagatcttgatctaggcccacctgtagatccagatgaagactctgacaac
agtgcaatttatgtacaaggattaaatgacagtgtgactctagatgatctggcagacttc
tttaagcagtgtggggttgttaagatgaacaagagaactgggcaacccatgatccacatc
tacctggacaaggaaacaggaaagcccaaaggcgatgccacagtgtcctatgaagaccca
cccactgccaaggctgccgtggaatggtttgatgggaaagattttcaagggagcaaactt
aaagtctcccttgctcggaagaagcctccaatgaacagtatgcggggtggtctgccaccc
cgtgagggcagaggcatgccaccaccactccgtggaggtccaggaggcccaggaggtcct
gggggacccatgggtcgcatgggaggccgtggaggagatagaggaggcttccctccaaga
ggaccccggggttcccgagggaacccctctggaggaggaaacgtccagcaccgagctgga
gactggcagtgtcccaatccgggttgtggaaaccagaacttcgcctggagaacagagtgc
aaccagtgtaaggccccaaagcctgaaggcttcctcccgccaccctttccgcccccgggt
ggtgatcgtggcagaggtggccctggtggcatgcggggaggaagaggtggcctcatggat
cgtggtggtcccggtggaatgttcagaggtggccgtggtggagacagaggtggcttccgt
ggtggccggggcatggaccgaggtggctttggtggaggaagacgaggtggccctgggggg
ccccctggacctttgatggaacagatgggaggaagaagaggaggacgtggaggacctgga
aaaatggataaaggcgagcaccgtcaggagcgcagagatcggccctactag

DBGET integrated database retrieval system