KEGG   Homo sapiens (human): 2147Help
Entry
2147              CDS       T01001                                 

Gene name
F2, PT, RPRGL2, THPH1
Definition
coagulation factor II (thrombin) (EC:3.4.21.5)
Orthology
K01313  
coagulation factor II (thrombin) [EC:3.4.21.5]
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Regulation of actin cytoskeleton
Disease
H00223  
Inherited thrombophilia
H01254  
Congenital prothrombin deficiency
Drug target
Desirudin: 
Lepirudin: 
Argatroban: 
Melagatran: 
Ximelagatran: 
Bivalirudin: 
Dabigatran etexilate: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2147 (F2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2147 (F2)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2147 (F2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.5  thrombin
     2147 (F2)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   2147 (F2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   2147 (F2)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
  2147 (F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 
3RM2 3VXE 2BVR 2UUF 3SI4 3U8O 3SV2 2CN0 2CF8 2UUJ 3RM0 3QX5 2UUK 3RMO 2BVS 1H8D 3P17 3U98 3T5F 3U8R 2ZFF 1C5L 3UWJ 3D49 1C5N 3RLY 3SHA 3QTO 3RML 3EQ0 2PGB 1VZQ 3UTU 3U69 3SI3 3GIC 3BEI 1SHH 3U9A 3RMM 2ZC9 1O2G 4CH2 3VXF 3JZ1 3DUX 2ZGB 3B9F 1AHT 2BDY 3QTV 4LZ1 3PO1 2ZIQ 2ZI2 1W7G 1GHX 1OYT 3RLW 3P6Z 2ZO3 2JH0 1DOJ 2ZDV 3DHK 2ZDA 1GJ5 4CH8 3R3G 3QWC 3F68 2ZG0 2OD3 1O5G 1H8I 1GHW 1C1U 3RMN 1YPJ 1YPK 2V3O 2V3H 2CF9 4DIH 3LU9 3DA9 2ZNK 2ZGX 2ZFQ 3BV9 3BIV 2PGQ 1Z71 1YPG 1NM6 1JOU 1EB1 1QBV 1BA8 1A4W 1A3B 1AY6 1TOM 1YPE 1SL3 1GJ4 2BXT 3C1K 2PW8 3K65 2ZFR 1YPL 1YPM 1XMN 1GHV 1GHY 1A3E 1AI8 3U8T 1K21 4BAN 4BAO 2GP9 4BAM 4BAQ 4AX9 4DT7 3SQE 3SHC 3S7H 3S7K 3DD2 2A0Q 1ZRB 1TA6 1SB1 1NO9 1G32 1C5O 1C1W 1VR1 1SFQ 1PPB 2AFQ 1K22 4N3L 4BAH 4BAK 1LHC 2ZHQ 2C8W 4NZE 2ZHF 1C1V 1MU6 2GDE 1Z8I 1Z8J 1T4U 1T4V 1NT1 1MU8 1MUE 1G30 1G37 1DE7 1D6W 1QUR 1QJ1 1BCU 1AE8 1AFE 1AD8 1UMA 1HBT 1HAG 1IHS 2ZHW 1WAY 1RIW 1D3D 4DII 1A5G 1D4P 1B5G 3QGN 3E6P 2ZHE 2R2M 2B5T 1KTT 1EOJ 1EOL 1D3P 1C4U 1C4V 8KME 7KME 1THP 2THF 1B7X 1BB0 1CA8 1A2C 5GDS 1AIX 1HXF 1HXE 1IHT 1A46 3QLP 2C8Z 2C8X 3C27 1NZQ 4H6S 4MLF 3SQH 3NXP 3EGK 2ZF0 3BEF 2C93 2C8Y 1ZGV 1ZGI 1WBG 1NU7 1NU9 1JMO 1QJ6 1QJ7 1QHR 1A61 1AWF 1TMT 1THS 1HGT 2HGT 2JH6 4E7R 3LDX 2ZFP 2C90 1LHE 1LHG 4E05 3BIU 1XM1 1TA2 1SG8 1SGI 1OOK 1NY2 1DX5 1D9I 1BHX 1TBZ 1DIT 1FPC 1HAH 4HTC 1THR 3HTC 1TMB 1ABI 1LHD 4I7Y 4HFP 4H6T 3B23 3JZ2 3GIS 3DT0 2HWL 2H9T 2ANM 1TWX 1TQ7 1KTS 1LHF 1HAI 1NRR 1NRS 1ABJ 2FES 2FEQ 2A2X 1O0D 2ANK 3TU7 3BF6 2PKS 2JH5 1TB6 1RD3 1JWT 1DM4 4THN 3HAT 2HNT 1TMU 1FPH 3P70 4LZ4 4BOH 4AYY 4AZ2 3HKJ 1P8V 1BMM 1HDT 1C4Y 3EE0 4AYV 4DY7 3QDZ 2BXU 1TQ0 1MH0 1UVS 1BMN 1HAO 1HAP 1D3Q 1HUT 4HFY 1D3T 1AWH 1HLT 1NRP 1DWC 1DWD 1DWE 1SR5 1NRN 1NRO 1DWB 4E06 3PMH 2BVX 4HZH 2HPP 2HPQ 1NRQ 2A45 1E0F
Thumbnails

Jmol
Position
11p11
AA seq 622 aa AA seqDB search
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgtccgaggcttgcagctgcctggctgcctggccctggctgccctgtgtagc
cttgtgcacagccagcatgtgttcctggctcctcagcaagcacggtcgctgctccagcgg
gtccggcgagccaacaccttcttggaggaggtgcgcaagggcaacctggagcgagagtgc
gtggaggagacgtgcagctacgaggaggccttcgaggctctggagtcctccacggctacg
gatgtgttctgggccaagtacacagcttgtgagacagcgaggacgcctcgagataagctt
gctgcatgtctggaaggtaactgtgctgagggtctgggtacgaactaccgagggcatgtg
aacatcacccggtcaggcattgagtgccagctatggaggagtcgctacccacataagcct
gaaatcaactccactacccatcctggggccgacctacaggagaatttctgccgcaacccc
gacagcagcaccacgggaccctggtgctacactacagaccccaccgtgaggaggcaggaa
tgcagcatccctgtctgtggccaggatcaagtcactgtagcgatgactccacgctccgaa
ggctccagtgtgaatctgtcacctccattggagcagtgtgtccctgatcgggggcagcag
taccaggggcgcctggcggtgaccacacatgggctcccctgcctggcctgggccagcgca
caggccaaggccctgagcaagcaccaggacttcaactcagctgtgcagctggtggagaac
ttctgccgcaacccagacggggatgaggagggcgtgtggtgctatgtggccgggaagcct
ggcgactttgggtactgcgacctcaactattgtgaggaggccgtggaggaggagacagga
gatgggctggatgaggactcagacagggccatcgaagggcgtaccgccaccagtgagtac
cagactttcttcaatccgaggacctttggctcgggagaggcagactgtgggctgcgacct
ctgttcgagaagaagtcgctggaggacaaaaccgaaagagagctcctggaatcctacatc
gacgggcgcattgtggagggctcggatgcagagatcggcatgtcaccttggcaggtgatg
cttttccggaagagtccccaggagctgctgtgtggggccagcctcatcagtgaccgctgg
gtcctcaccgccgcccactgcctcctgtacccgccctgggacaagaacttcaccgagaat
gaccttctggtgcgcattggcaagcactcccgcaccaggtacgagcgaaacattgaaaag
atatccatgttggaaaagatctacatccaccccaggtacaactggcgggagaacctggac
cgggacattgccctgatgaagctgaagaagcctgttgccttcagtgactacattcaccct
gtgtgtctgcccgacagggagacggcagccagcttgctccaggctggatacaaggggcgg
gtgacaggctggggcaacctgaaggagacgtggacagccaacgttggtaaggggcagccc
agtgtcctgcaggtggtgaacctgcccattgtggagcggccggtctgcaaggactccacc
cggatccgcatcactgacaacatgttctgtgctggttacaagcctgatgaagggaaacga
ggggatgcctgtgaaggtgacagtgggggaccctttgtcatgaagagcccctttaacaac
cgctggtatcaaatgggcatcgtctcatggggtgaaggctgtgaccgggatgggaaatat
ggcttctacacacatgtgttccgcctgaagaagtggatacagaaggtcattgatcagttt
ggagagtag

DBGET integrated database retrieval system