KEGG   Homo sapiens (human): 2153Help
Entry
2153              CDS       T01001                                 

Gene name
F5, FVL, PCCF, RPRGL1, THPH2
Definition
coagulation factor V (proaccelerin, labile factor)
Orthology
K03902  
coagulation factor V (labile factor)
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00220  
Factor V deficiency
H00223  
Inherited thrombophilia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2153 (F5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 2224 aa AA seqDB search
MFPGCPRLWVLVVLGTSWVGWGSQGTEAAQLRQFYVAAQGISWSYRPEPTNSSLNLSVTS
FKKIVYREYEPYFKKEKPQSTISGLLGPTLYAEVGDIIKVHFKNKADKPLSIHPQGIRYS
KLSEGASYLDHTFPAEKMDDAVAPGREYTYEWSISEDSGPTHDDPPCLTHIYYSHENLIE
DFNSGLIGPLLICKKGTLTEGGTQKTFDKQIVLLFAVFDESKSWSQSSSLMYTVNGYVNG
TMPDITVCAHDHISWHLLGMSSGPELFSIHFNGQVLEQNHHKVSAITLVSATSTTANMTV
GPEGKWIISSLTPKHLQAGMQAYIDIKNCPKKTRNLKKITREQRRHMKRWEYFIAAEEVI
WDYAPVIPANMDKKYRSQHLDNFSNQIGKHYKKVMYTQYEDESFTKHTVNPNMKEDGILG
PIIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDEVNSSFTSGRNNTMIRAVQPGET
YTYKWNILEFDEPTENDAQCLTRPYYSDVDIMRDIASGLIGLLLICKSRSLDRRGIQRAA
DIEQQAVFAVFDENKSWYLEDNINKFCENPDEVKRDDPKFYESNIMSTINGYVPESITTL
GFCFDDTVQWHFCSVGTQNEILTIHFTGHSFIYGKRHEDTLTLFPMRGESVTVTMDNVGT
WMLTSMNSSPRSKKLRLKFRDVKCIPDDDEDSYEIFEPPESTVMATRKMHDRLEPEDEES
DADYDYQNRLAAALGIRSFRNSSLNQEEEEFNLTALALENGTEFVSSNTDIIVGSNYSSP
SNISKFTVNNLAEPQKAPSHQQATTAGSPLRHLIGKNSVLNSSTAEHSSPYSEDPIEDPL
QPDVTGIRLLSLGAGEFKSQEHAKHKGPKVERDQAAKHRFSWMKLLAHKVGRHLSQDTGS
PSGMRPWEDLPSQDTGSPSRMRPWKDPPSDLLLLKQSNSSKILVGRWHLASEKGSYEIIQ
DTDEDTAVNNWLISPQNASRAWGESTPLANKPGKQSGHPKFPRVRHKSLQVRQDGGKSRL
KKSQFLIKTRKKKKEKHTHHAPLSPRTFHPLRSEAYNTFSERRLKHSLVLHKSNETSLPT
DLNQTLPSMDFGWIASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHS
TSDPSHRSSSPELSEMLEYDRSHKSFPTDISQMSPSSEHEVWQTVISPDLSQVTLSPELS
QTNLSPDLSHTTLSPELIQRNLSPALGQMPISPDLSHTTLSPDLSHTTLSLDLSQTNLSP
ELSQTNLSPALGQMPLSPDLSHTTLSLDFSQTNLSPELSHMTLSPELSQTNLSPALGQMP
ISPDLSHTTLSLDFSQTNLSPELSQTNLSPALGQMPLSPDPSHTTLSLDLSQTNLSPELS
QTNLSPDLSEMPLFADLSQIPLTPDLDQMTLSPDLGETDLSPNFGQMSLSPDLSQVTLSP
DISDTTLLPDLSQISPPPDLDQIFYPSESSQSLLLQEFNESFPYPDLGQMPSPSSPTLND
TFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINS
SRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTTYKKVVF
RKYLDSTFTKRDPRGEYEEHLGILGPIIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKS
SEGKTYEDDSPEWFKEDNAVQPNSSYTYVWHATERSGPESPGSACRAWAYYSAVNPEKDI
HSGLIGPLLICQKGILHKDSNMPMDMREFVLLFMTFDEKKSWYYEKKSRSSWRLTSSEMK
KSHEFHAINGMIYSLPGLKMYEQEWVRLHLLNIGGSQDIHVVHFHGQTLLENGNKQHQLG
VWPLLPGSFKTLEMKASKPGWWLLNTEVGENQRAGMQTPFLIMDRDCRMPMGLSTGIISD
SQIKASEFLGYWEPRLARLNNGGSYNAWSVEKLAAEFASKPWIQVDMQKEVIITGIQTQG
AKHYLKSCYTTEFYVAYSSNQINWQIFKGNSTRNVMYFNGNSDASTIKENQFDPPIVARY
IRISPTRAYNRPTLRLELQGCEVNGCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFR
ARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQ
GVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSIALRLELFG
CDIY
NT seq 6675 nt NT seq  +upstreamnt  +downstreamnt
atgttcccaggctgcccacgcctctgggtcctggtggtcttgggcaccagctgggtaggc
tgggggagccaagggacagaagcggcacagctaaggcagttctacgtggctgctcagggc
atcagttggagctaccgacctgagcccacaaactcaagtttgaatctttctgtaacttcc
tttaagaaaattgtctacagagagtatgaaccatattttaagaaagaaaaaccacaatct
accatttcaggacttcttgggcctactttatatgctgaagtcggagacatcataaaagtt
cactttaaaaataaggcagataagcccttgagcatccatcctcaaggaattaggtacagt
aaattatcagaaggtgcttcttaccttgaccacacattccctgcggagaagatggacgac
gctgtggctccaggccgagaatacacctatgaatggagtatcagtgaggacagtggaccc
acccatgatgaccctccatgcctcacacacatctattactcccatgaaaatctgatcgag
gatttcaactcggggctgattgggcccctgcttatctgtaaaaaagggaccctaactgag
ggtgggacacagaagacgtttgacaagcaaatcgtgctactatttgctgtgtttgatgaa
agcaagagctggagccagtcatcatccctaatgtacacagtcaatggatatgtgaatggg
acaatgccagatataacagtttgtgcccatgaccacatcagctggcatctgctgggaatg
agctcggggccagaattattctccattcatttcaacggccaggtcctggagcagaaccat
cataaggtctcagccatcacccttgtcagtgctacatccactaccgcaaatatgactgtg
ggcccagagggaaagtggatcatatcttctctcaccccaaaacatttgcaagctgggatg
caggcttacattgacattaaaaactgcccaaagaaaaccaggaatcttaagaaaataact
cgtgagcagaggcggcacatgaagaggtgggaatacttcattgctgcagaggaagtcatt
tgggactatgcacctgtaataccagcgaatatggacaaaaaatacaggtctcagcatttg
gataatttctcaaaccaaattggaaaacattataagaaagttatgtacacacagtacgaa
gatgagtccttcaccaaacatacagtgaatcccaatatgaaagaagatgggattttgggt
cctattatcagagcccaggtcagagacacactcaaaatcgtgttcaaaaatatggccagc
cgcccctatagcatttaccctcatggagtgaccttctcgccttatgaagatgaagtcaac
tcttctttcacctcaggcaggaacaacaccatgatcagagcagttcaaccaggggaaacc
tatacttataagtggaacatcttagagtttgatgaacccacagaaaatgatgcccagtgc
ttaacaagaccatactacagtgacgtggacatcatgagagacatcgcctctgggctaata
ggactacttctaatctgtaagagcagatccctggacaggcgaggaatacagagggcagca
gacatcgaacagcaggctgtgtttgctgtgtttgatgagaacaaaagctggtaccttgag
gacaacatcaacaagttttgtgaaaatcctgatgaggtgaaacgtgatgaccccaagttt
tatgaatcaaacatcatgagcactatcaatggctatgtgcctgagagcataactactctt
ggattctgctttgatgacactgtccagtggcacttctgtagtgtggggacccagaatgaa
attttgaccatccacttcactgggcactcattcatctatggaaagaggcatgaggacacc
ttgaccctcttccccatgcgtggagaatctgtgacggtcacaatggataatgttggaact
tggatgttaacttccatgaattctagtccaagaagcaaaaagctgaggctgaaattcagg
gatgttaaatgtatcccagatgatgatgaagactcatatgagatttttgaacctccagaa
tctacagtcatggctacacggaaaatgcatgatcgtttagaacctgaagatgaagagagt
gatgctgactatgattaccagaacagactggctgcagcattaggaatcaggtcattccga
aactcatcattgaatcaggaagaagaagagttcaatcttactgccctagctctggagaat
ggcactgaattcgtttcttcaaacacagatataattgttggttcaaattattcttcccca
agtaatattagtaagttcactgtcaataaccttgcagaacctcagaaagccccttctcac
caacaagccaccacagctggttccccactgagacacctcattggcaagaactcagttctc
aattcttccacagcagagcattccagcccatattctgaagaccctatagaggatcctcta
cagccagatgtcacagggatacgtctactttcacttggtgctggagaattcaaaagtcaa
gaacatgctaagcataagggacccaaggtagaaagagatcaagcagcaaagcacaggttc
tcctggatgaaattactagcacataaagttgggagacacctaagccaagacactggttct
ccttccggaatgaggccctgggaggaccttcctagccaagacactggttctccttccaga
atgaggccctggaaggaccctcctagtgatctgttactcttaaaacaaagtaactcatct
aagattttggttgggagatggcatttggcttctgagaaaggtagctatgaaataatccaa
gatactgatgaagacacagctgttaacaattggctgatcagcccccagaatgcctcacgt
gcttggggagaaagcacccctcttgccaacaagcctggaaagcagagtggccacccaaag
tttcctagagttagacataaatctctacaagtaagacaggatggaggaaagagtagactg
aagaaaagccagtttctcattaagacacgaaaaaagaaaaaagagaagcacacacaccat
gctcctttatctccgaggacctttcaccctctaagaagtgaagcctacaacacattttca
gaaagaagacttaagcattcgttggtgcttcataaatccaatgaaacatctcttcccaca
gacctcaatcagacattgccctctatggattttggctggatagcctcacttcctgaccat
aatcagaattcctcaaatgacactggtcaggcaagctgtcctccaggtctttatcagaca
gtgcccccagaggaacactatcaaacattccccattcaagaccctgatcaaatgcactct
acttcagaccccagtcacagatcctcttctccagagctcagtgaaatgcttgagtatgac
cgaagtcacaagtccttccccacagatataagtcaaatgtccccttcctcagaacatgaa
gtctggcagacagtcatctctccagacctcagccaggtgaccctctctccagaactcagc
cagacaaacctctctccagacctcagccacacgactctctctccagaactcattcagaga
aacctttccccagccctcggtcagatgcccatttctccagacctcagccatacaaccctt
tctccagacctcagccatacaaccctttctttagacctcagccagacaaacctctctcca
gaactcagtcagacaaacctttctccagccctcggtcagatgcccctttctccagacctc
agccatacaaccctttctctagacttcagccagacaaacctctctccagaactcagccat
atgactctctctccagaactcagtcagacaaacctttccccagccctcggtcagatgccc
atttctccagacctcagccatacaaccctttctctagacttcagccagacaaacctctct
ccagaactcagtcaaacaaacctttccccagccctcggtcagatgcccctttctccagac
cccagccatacaaccctttctctagacctcagccagacaaacctctctccagaactcagt
cagacaaacctttccccagacctcagtgagatgcccctctttgcagatctcagtcaaatt
ccccttaccccagacctcgaccagatgacactttctccagaccttggtgagacagatctt
tccccaaactttggtcagatgtccctttccccagacctcagccaggtgactctctctcca
gacatcagtgacaccacccttctcccggatctcagccagatatcacctcctccagacctt
gatcagatattctacccttctgaatctagtcagtcattgcttcttcaagaatttaatgag
tcttttccttatccagaccttggtcagatgccatctccttcatctcctactctcaatgat
acttttctatcaaaggaatttaatccactggttatagtgggcctcagtaaagatggtaca
gattacattgagatcattccaaaggaagaggtccagagcagtgaagatgactatgctgaa
attgattatgtgccctatgatgacccctacaaaactgatgttaggacaaacatcaactcc
tccagagatcctgacaacattgcagcatggtacctccgcagcaacaatggaaacagaaga
aattattacattgctgctgaagaaatatcctgggattattcagaatttgtacaaagggaa
acagatattgaagactctgatgatattccagaagataccacatataagaaagtagttttt
cgaaagtacctcgacagcacttttaccaaacgtgatcctcgaggggagtatgaagagcat
ctcggaattcttggtcctattatcagagctgaagtggatgatgttatccaagttcgtttt
aaaaatttagcatccagaccgtattctctacatgcccatggactttcctatgaaaaatca
tcagagggaaagacttatgaagatgactctcctgaatggtttaaggaagataatgctgtt
cagccaaatagcagttatacctacgtatggcatgccactgagcgatcagggccagaaagt
cctggctctgcctgtcgggcttgggcctactactcagctgtgaacccagaaaaagatatt
cactcaggcttgataggtcccctcctaatctgccaaaaaggaatactacataaggacagc
aacatgcctatggacatgagagaatttgtcttactatttatgacctttgatgaaaagaag
agctggtactatgaaaagaagtcccgaagttcttggagactcacatcctcagaaatgaaa
aaatcccatgagtttcacgccattaatgggatgatctacagcttgcctggcctgaaaatg
tatgagcaagagtgggtgaggttacacctgctgaacataggcggctcccaagacattcac
gtggttcactttcacggccagaccttgctggaaaatggcaataaacagcaccagttaggg
gtctggccccttctgcctggttcatttaaaactcttgaaatgaaggcatcaaaacctggc
tggtggctcctaaacacagaggttggagaaaaccagagagcagggatgcaaacgccattt
cttatcatggacagagactgtaggatgccaatgggactaagcactggtatcatatctgat
tcacagatcaaggcttcagagtttctgggttactgggagcccagattagcaagattaaac
aatggtggatcttataatgcttggagtgtagaaaaacttgcagcagaatttgcctctaaa
ccttggatccaggtggacatgcaaaaggaagtcataatcacagggatccagacccaaggt
gccaaacactacctgaagtcctgctataccacagagttctatgtagcttacagttccaac
cagatcaactggcagatcttcaaagggaacagcacaaggaatgtgatgtattttaatggc
aattcagatgcctctacaataaaagagaatcagtttgacccacctattgtggctagatat
attaggatctctccaactcgagcctataacagacctacccttcgattggaactgcaaggt
tgtgaggtaaatggatgttccacacccctgggtatggaaaatggaaagatagaaaacaag
caaatcacagcttcttcgtttaagaaatcttggtggggagattactgggaacccttccgt
gcccgtctgaatgcccagggacgtgtgaatgcctggcaagccaaggcaaacaacaataag
cagtggctagaaattgatctactcaagatcaagaagataacggcaattataacacagggc
tgcaagtctctgtcctctgaaatgtatgtaaagagctataccatccactacagtgagcag
ggagtggaatggaaaccatacaggctgaaatcctccatggtggacaagatttttgaagga
aatactaataccaaaggacatgtgaagaactttttcaaccccccaatcatttccaggttt
atccgtgtcattcctaaaacatggaatcaaagtattgcacttcgcctggaactctttggc
tgtgatatttactag

DBGET integrated database retrieval system