KEGG   Homo sapiens (human): 2166Help
Entry
2166              CDS       T01001                                 

Gene name
FAAH, FAAH-1, PSAB
Definition
fatty acid amide hydrolase (EC:3.5.1.99)
Orthology
K15528  
fatty acid amide hydrolase [EC:3.5.1.99]
Organism
hsa  Homo sapiens (human)
Pathway
Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    2166 (FAAH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.99  fatty acid amide hydrolase
     2166 (FAAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p35-p34
AA seq 579 aa AA seqDB search
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagtacgagctgtgggccgcgctgcctggcgcctccggggtcgccctggcctgc
tgcttcgtggcggcggccgtggccctgcgctggtccgggcgccggacggcgcggggcgcg
gtggtccgggcgcgacagaggcagcgagcgggcctggagaacatggacagggcggcgcag
cgcttccggctccagaacccagacctggactcagaggcgctgctagccctgcccctgcct
cagctggtgcagaagttacacagtagagagctggcccctgaggccgtgctcttcacctat
gtgggaaaggcctgggaagtgaacaaagggaccaactgtgtgacctcctatctggctgac
tgtgagactcagctgtctcaggccccaaggcagggcctgctctatggcgtccctgtgagc
ctcaaggagtgcttcacctacaagggccaggactccacgctgggcttgagcctgaatgaa
ggggtgccggcggagtgcgacagcgtagtggtgcatgtgctgaagctgcagggtgccgtg
cccttcgtgcacaccaatgttccacagtccatgttcagctatgactgcagtaaccccctc
tttggccagaccgtgaacccatggaagtcctccaaaagcccagggggctcctcagggggt
gaaggggccctcatcgggtctggaggctcccccctgggcttaggcactgatatcggaggc
agcatccgcttcccctcctccttctgcggcatctgcggcctcaagcccacagggaaccgc
ctcagcaagagtggcctgaagggctgtgtctatggacaggaggcagtgcgtctctccgtg
ggccccatggcccgggacgtggagagcctggcactgtgcctgcgagccctgctgtgcgag
gacatgttccgcttggaccccactgtgcctcccttgcccttcagagaagaggtctacacc
agctctcagcccctgcgtgtggggtactatgagactgacaactataccatgccctccccg
gccatgaggcgggccgtgctggagaccaaacagagccttgaggctgcggggcacacgctg
gttcccttcttgccaagcaacataccccatgctctggagaccctgtcaacaggtgggctc
ttcagtgatggtggccacaccttcctacagaacttcaaaggtgatttcgtggacccctgc
ctgggggacctggtctcaattctgaagcttccccaatggcttaaaggactgctggccttc
ctggtgaagcctctgctgccaaggctgtcagctttcctcagcaacatgaagtctcgttcg
gctggaaaactctgggaactgcagcacgagatcgaggtgtaccgcaaaaccgtgattgcc
cagtggagggcgctggacctggatgtggtgctgacccccatgctggcccctgctctggac
ttgaatgccccaggcagggccacaggggccgtcagctacactatgctgtacaactgcctg
gacttccctgcaggggtggtgcctgtcaccacggtgactgctgaggacgaggcccagatg
gaacattacaggggctactttggggatatctgggacaagatgctgcagaagggcatgaag
aagagtgtggggctgccggtggccgtgcagtgtgtggctctgccctggcaagaagagttg
tgtctgcggttcatgcgggaggtggagcgactgatgacccctgaaaagcagtcatcctga

DBGET integrated database retrieval system