KEGG   Homo sapiens (human): 2189Help
Entry
2189              CDS       T01001                                 

Gene name
FANCG, FAG, XRCC9
Definition
Fanconi anemia, complementation group G
Orthology
K10894  
fanconi anemia group G protein
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Module
FA core complex
Disease
H00238  
Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    2189 (FANCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13
AA seq 622 aa AA seqDB search
MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGL
PAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRE
LWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLL
LKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLC
PRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSAWGPPLLEASRLYQQLGDTTAEL
ESLELLVEALNVPCSSKAPQFLIEVELLLPPPDLASPLHCGTQSQTKHILASRCLQTGRA
GDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDALTLCEEL
LSRTSSLLPKMSRLWEDARKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFSRCL
ELLFRATPEEKEQGAAFNCEQGCKSDAALQQLRAAALISRGLEWVASGQDTKALQDFLLS
VQMCPGNRDTYFHLLQTLKRLDRRDEATALWWRLEAQTKGSHEDALWSLPLYLESYLSWI
RPSDRDAFLEEFRTSLPKSCDL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgccagaccacctctgtgggctccagctgcctggacctgtggagggaaaagaat
gaccggctcgttcgacaggccaaggtggctcagaactccggtctgactctgaggcgacag
cagttggctcaggatgcactggaagggctcagagggctcctccatagtctgcaagggctc
cctgcagctgttcctgttcttcccttggagctgactgtcacctgcaacttcattatcctg
agggcaagcttggcccagggtttcacagaggatcaggcccaggatatccagcggagccta
gagagagtgctggagacacaggagcagcaggggcccaggttggaacaggggctcagggag
ctgtgggactctgtccttcgtgcttcctgccttctgccggagctgctgtctgccctgcac
cgcctggttggcctgcaggctgccctctggttgagtgctgaccgtcttggggacctggcc
ttgttactagagaccctgaatggcagccagagtggagcctctaaggatctgctgttactt
ctgaaaacttggagtcccccagctgaggaattagatgctccattgaccctgcaggatgcc
cagggattgaaggatgtcctcctgacagcatttgcctaccgccaaggtctccaggagctg
atcacagggaacccagacaaggcactaagcagccttcatgaagcggcctcaggcctgtgt
ccacggcctgtgttggtccaggtgtacacagcactggggtcctgtcaccgtaagatggga
aatccacagagagcactgttgtacttggttgcagccctgaaagagggatcagcctggggt
cctccacttctggaggcctctaggctctatcagcaactgggggacacaacagcagagctg
gagagtctggagctgctagttgaggccttgaatgtcccatgcagttccaaagccccgcag
tttctcattgaggtagaattactactgccaccacctgacctagcctcaccccttcattgt
ggcactcagagccagaccaagcacatactagcaagcaggtgcctacagacggggagggca
ggagacgctgcagagcattacttggacctgctggccctgttgctggatagctcggagcca
aggttctccccacccccctcccctccagggccctgtatgcctgaggtgtttttggaggca
gcggtagcactgatccaggcaggcagagcccaagatgccttgactctatgtgaggagttg
ctcagccgcacatcatctctgctacccaagatgtcccggctgtgggaagatgccagaaaa
ggaaccaaggaactgccatactgcccactctgggtctctgccacccacctgcttcagggc
caggcctgggttcaactgggtgcccaaaaagtggcaattagtgaatttagcaggtgcctc
gagctgctcttccgggccacacctgaggaaaaagaacaaggggcagctttcaactgtgag
cagggatgtaagtcagatgcggcactgcagcagcttcgggcagccgccctaattagtcgt
ggactggaatgggtagccagcggccaggataccaaagccttacaggacttcctcctcagt
gtgcagatgtgcccaggtaatcgagacacttactttcacctgcttcagactctgaagagg
ctagatcggagggatgaggccactgcactctggtggaggctggaggcccaaactaagggg
tcacatgaagatgctctgtggtctctccccctgtacctagaaagctatttgagctggatc
cgtccctctgatcgtgacgccttccttgaagaatttcggacatctctgccaaagtcttgt
gacctgtag

DBGET integrated database retrieval system