KEGG   Homo sapiens (human): 221927Help
Entry
221927            CDS       T01001                                 

Gene name
BRAT1, BAAT1, C7orf27, RMFSL
Definition
BRCA1-associated ATM activator 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p22.3
AA seq 821 aa AA seqDB search
MDPECAQLLPALCAVLVDPRQPVADDTCLEKLLDWFKTVTEGESSVVLLQEHPCLVELLS
HVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPGPLGRATWAVPTVR
SGWIQGLRSLAQHPSALRFLADHGAVDTIFSLQGDSSLFVASAASQLLVHVLALSMRGGA
EGQPCLPGGDWPACAQKIMDHVEESLCSAATPKVTQALNVLTTTFGRCQSPWTEALWVRL
SPRVACLLERDPIPAAHSFVDLLLCVARSPVFSSSDGSLWETVARALSCLGPTHMGPLAL
GILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATTVDTLLASKSS
CAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVLRLCDGSAAPASSVGGHLCGTLA
GCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECLESPGSSPTVLKKAFQATLRWLLS
SPKTPGCSDLGPLIPQFLRELFPVLQKRLCHPCWEVRDSALEFLTQLSRHWGGQADFRCA
LLASEVPQLALQLLQDPESYVRASAVTAMGQLSSQGLHAPTSPEHAEARQSLFLELLHIL
SVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEVRAQGLELALV
FLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRALCHVGLFDFAFCALFDCDRPVAQKSC
DLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAGEQAQPPGDQEPEAVLAMLRSLD
LEGLRSTLAESSDHVEKSPQSLLQDMLATGGFLQGDEADCY
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggacccagaatgcgcccagctgctcccggctctctgtgctgttctggtagatcccagg
cagccggtggcagatgacacctgtttggagaagctcctggactggtttaaaacggtcact
gaaggagagtccagtgtcgtgctgctgcaggagcacccctgcctggtggagctgctgtcc
catgtgctgaaagtccaggacctgagttctggggtcctctccttctcactgcgcctggca
ggaaccttcgcagcccaggaaaactgcttccagtatcttcagcagggggagttactacca
gggctctttggggagccaggacccctcggccgagcaacctgggccgtccccaccgtgcgc
agcggctggatccagggcctgcgctccctggcacagcaccccagcgccctgcgcttcctg
gccgaccatggtgcggtcgacaccatcttctccctgcagggagactccagcctgtttgtg
gcctcggcggccagtcagctcctggtgcacgtcctggctttgtccatgcgaggtggagcc
gaggggcagccctgcctgccggggggtgactggcccgcgtgtgcccagaagatcatggat
cacgttgaagagtccttgtgctccgcggccacccccaaggtcactcaggccctgaacgtc
ctgaccacgaccttcgggcgctgccagagcccctggacggaagccctgtgggtgcggctg
agtccccgcgtggcctgtctgctggagagagaccccatccccgccgcacactcgttcgtg
gacctgcttctctgtgtggctcgttctcccgtgttcagttcttccgacggcagcctgtgg
gagacagtggcgcgggctctgagctgcctgggtcccacccacatgggacccctggctttg
gggatcctgaagctcgagcactgtccacaggcactgaggacccaggccttccaggtcctt
ctccagcccctggcctgtgtcctgaaggccacggttcaggcccccggacccccaggcttg
ctggacgggacggcagacgatgccacgacggtggacacactcctggcctccaagtcgtcc
tgcgccggcctcctgtgccgcaccctggctcacctggaggagctgcagccgctgccccag
cgcccttcaccgtggccccaggcgtctctactgggggctacagtgactgtcctgcggctc
tgtgacggctcggctgcccctgcctccagtgtggggggccacctctgtgggaccctggcg
ggctgcgtccgggtccagcgagcagccctcgacttcctggggacgctgtcacaggggaca
ggcccccaggagctggtgacgcaggcgcttgctgtcctcctggagtgcctcgagagcccc
ggctccagccccacggttctgaagaaggccttccaggccacgctcaggtggctcctgagc
tcacccaagacccccggctgctctgatctcggccccctcatcccgcagttcctcagagag
ctgttccctgtgctgcagaaacgcctgtgccacccctgctgggaggtgagggactccgcc
ctcgagttcctgacccagctgagcaggcactggggaggacaggctgacttcagatgcgca
ctcttggcttcagaggtgcctcagctggccctgcagctcctccaggaccctgagagttat
gtccgagcgagtgcagtgaccgccatggggcagctgtccagccagggcctgcacgccccc
accagccctgagcatgcagaggcccggcagagcctgttcctggagctcctgcacatcctc
tccgtagactcggagggcttcccacggcgggcggtcatgcaagtcttcactgagtggctg
cgggacggccacgccgacgcggcccaggacacggagcagttcgtggccactgtgctgcag
gcggcgagccgagacctggactgggaggtccgcgcccagggcctggagctggccctcgtg
ttcctgggccagactttggggccgccgcgtacccactgcccctatgccgtggccctaccc
gaggtggccccagcccagccactcaccgaggcactgagggctctctgccacgtggggctc
tttgacttcgccttttgtgccttgtttgactgcgaccgccctgtggcgcagaagtcttgt
gacctccttctcttcctgagggacaagattgcttcctacagcagcctgcgggaggccagg
ggcagccccaacactgcctccgcagaggccaccctgccgaggtggcgggcgggtgagcag
gcccagcccccaggggaccaggagcctgaggctgtgctggccatgctcaggtccctagac
ctggagggcctgcggagcacgctggccgagagcagcgaccacgtggaaaagagtccccag
tccctcctgcaggacatgctggccacgggaggcttcctgcagggggacgaggccgactgc
tactga

DBGET integrated database retrieval system