KEGG   Homo sapiens (human): 2245Help
Entry
2245              CDS       T01001                                 

Gene name
FGD1, AAS, FGDY, MRXS16, ZFYVE3
Definition
FYVE, RhoGEF and PH domain containing 1
Orthology
K05720  
FYVE, RhoGEF and PH domain containing 1
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Disease
H00569  
Aarskog-Scott syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2245 (FGD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.21
AA seq 961 aa AA seqDB search
MHGHRAPGGAGPSEPEHPATNPPGAAPPACADSDPGASEPGLLARRGSGSALGGPLDPQF
VGPSDTSLGAAPGHRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPG
QSLEPHPEGPQRLRSDPGPPTETPSQRPSPLKRAPGPKPQVPPKPSYLQMPRMPPPLEPI
PPPPSRPLPADPRVAKGLAPRAEASPSSAAVSSLIEKFEREPVIVASDRPVPGPSPGPPE
PVMLPQPTSQPPVPQLPEGEASRCLFLLAPGPRDGEKVPNRDSGIDSISSPSNSEETCFV
SDDGPPSHSLCPGPPALASVPVALADPHRPGSQEVDSDLEEEDDEEEEEEKDREIPVPLM
ERQESVELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNRSSFPADVVHG
IFSNICSIYCFHQQFLLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVEL
VNTWTERSTQFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPD
SKDAQKSLELIATAAEHSNAAIRKMERMHKLLKVYELLGGEEDIVSPTKELIKEGHILKL
SAKNGTTQDRYLILFNDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESSNLNLPRTFLV
SGKQRSLELQARTEEEKKDWVQAINSTLLKHEQTLETFKLLNSTNREDEDTPPNSPNVDL
GKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNR
VCTDCYVALHGVPGSSPACSQHTPQRRRSILEKQASVAAENSVICSFLHYMEKGGKGWHK
AWFVVPENEPLVLYIYGAPQDVKAQRSLPLIGFEVGPPEAGERPDRRHVFKITQSHLSWY
FSPETEELQRRWMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDK
T
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgcatggccaccgagccccggggggcgccgggccttcggagcccgaacacccggccacg
aacccgccgggcgccgctccgccggcctgtgccgactcggaccctggagcctcggaaccc
ggactgctggcgcgcaggggctcaggttcggctcttggcggcccactggatccccagttt
gtcggaccctcggacaccagcctgggcgctgctccaggccaccgggtcttgccctgcggt
cccagtccacagcaccaccgggccctgcgcttctcttaccacctggagggctcgcagcct
cggcctgggctgcaccagggaaaccggatcctggttaaaagtttgtcccttgaccctggc
caaagcctagagcctcatccagaaggtccccagcggcttcgctcagacccaggtcccccg
actgaaacccctagccagcgtccttcaccactgaagcgggcaccgggcccgaagccacag
gtgcccccaaagcccagctacctgcagatgccccggatgccccccccactggagcccatc
ccccctccaccatcacgcccactgcctgccgacccccgagtggccaagggcctggctccc
agggcagaggccagccccagttctgcagcagtatcctcactgattgagaagtttgaaaga
gagcctgtgattgtcgcctcggatagaccagtccctggccccagcccaggtcccccagag
ccagtcatgttgccacagccaacctcgcagccaccagtgccccagctccccgagggtgag
gcctcccgctgcctgtttctgctggctcctgggccccgggacggtgagaaggtgcccaac
cgggacagcggcattgatagcatcagctcgccatccaacagcgaggagacctgcttcgtc
agtgatgacgggccccccagccacagcctctgccctgggccccctgccctggctagtgtg
cctgttgccttggccgacccccaccggcctggctcccaagaggttgacagtgacctggag
gaggaggacgacgaggaggaggaggaagagaaggacagagaaatcccagtgcccctgatg
gagagacaggagtctgtggagttgactgtgcagcaaaaggtgtttcacattgccaatgag
ctcctgcaaactgagaaggcctacgtttccaggctccatctcctggatcaggtgttctgt
gcccggctgctggaagaagctcggaaccgcagttccttcccggccgacgttgtccacggc
atcttctctaacatctgctccatctattgcttccaccagcagttcctgctgcctgagcta
gagaagcgcatggaggaatgggaccgctatccacgcattggagacatcctgcagaaactg
gcccccttcctcaagatgtatggtgagtatgtgaagaactttgaccgggccgtggagctg
gtcaacacctggacagagcgctccacccagtttaaagtcatcatccatgaggtgcagaag
gaggaagcctgtggcaacctgacattgcagcaccacatgctggagcctgtgcagcgcatc
ccccgctatgagcttcttctcaaggactatctgttaaagctgccccatggctccccggac
agcaaggatgcccaaaagtctctggagctgatcgccacagcagcagagcactcgaatgct
gccatccgcaaaatggagcgaatgcataagctgctgaaggtatatgagctgttagggggc
gaggaggacattgtcagccccaccaaagagctcataaaagaaggccacatccttaagctg
tcagcaaagaatgggaccactcaagaccgatacctcatactattcaacgaccgcctcctt
tactgcgtgcccaggctgcggctccttggccagaagtttagcgtgcgggcacgcattgat
gtagatggcatggagctaaaggagagctccaacctcaatctgcctcgaaccttcctggtg
tcaggaaagcagcgctccctcgagctccaggccaggactgaggaggagaagaaagactgg
gtccaggccatcaactccaccctcctgaagcatgaacagacgctggagactttcaaactg
ttgaactcaacaaacagggaagatgaagacaccccacccaactctccaaacgtggatctt
gggaagcgggcacctacgcccatccgggaaaaggaagtcaccatgtgcatgcgctgccag
gagcccttcaattctatcaccaaacgcaggcaccactgcaaggcctgcgggcatgtggtt
tgtgggaagtgctccgagttccgggcccgcctcgtctatgacaacaaccgctccaaccgt
gtgtgcactgattgctatgtggccttgcacggggtgcctgggagcagtccagcctgcagc
cagcatacaccccagcgccggaggtccatcctggagaaacaggcctcagtggctgcagag
aacagcgtcatctgcagcttcctgcactacatggagaagggtggcaaaggatggcacaag
gcatggttcgtggtccctgaaaatgaacccttggtgctgtatatctacggagcccctcag
gatgtgaaagcccagcgcagcctgcccctcattggcttcgaggtgggaccgcccgaggca
ggggagcggcctgacagaaggcatgtcttcaagatcacccagagccacctcagctggtac
ttcagccctgagacagaggaactacagcgacgctggatggctgtgcttggccgggcgggc
cgaggggacacgttctgcccggggcccacactgtctgaggacagggagatggaggaggca
ccggtggctgctttaggagccactgctgaaccccccgaatccccccagacccgagacaag
acctag

DBGET integrated database retrieval system