KEGG   Homo sapiens (human): 22930Help
Entry
22930             CDS       T01001                                 

Gene name
RAB3GAP1, P130, RAB3GAP, RAB3GAP130, WARBM1
Definition
(RefSeq) RAB3 GTPase activating protein catalytic subunit 1
  KO
K18270  
Rab3 GTPase-activating protein catalytic subunit
Organism
hsa  Homo sapiens (human)
Disease
H00271  
Polymicrogyria
H00792  
Warburg micro syndrome
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22930 (RAB3GAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21.3
AA seq 981 aa AA seqDB search
MAADSEPESEVFEITDFTTASEWERFISKVEEVLNDWKLIGNSLGKPLEKGIFTSGTWEE
KSDEISFADFKFSVTHHYLVQESTDKEGKDELLEDVVPQSMQDLLGMNNDFPPRAHCLVR
WYGLREFVVIAPAAHSDAVLSESKCNLLLSSVSIALGNTGCQVPLFVQIHHKWRRMYVGE
CQGPGVRTDFEMVHLRKVPNQYTHLSGLLDIFKSKIGCPLTPLPPVSIAIRFTYVLQDWQ
QYFWPQQPPDIDALVGGEVGGLEFGKLPFGACEDPISELHLATTWPHLTEGIIVDNDVYS
DLDPIQAPHWSVRVRKAENPQCLLGDFVTEFFKICRRKESTDEILGRSAFEEEGKETADI
THALSKLTEPASVPIHKLSVSNMVHTAKKKIRKHRGVEESPLNNDVLNTILLFLFPDAVS
EKPLDGTTSTDNNNPPSESEDYNLYNQFKSAPSDSLTYKLALCLCMINFYHGGLKGVAHL
WQEFVLEMRFRWENNFLIPGLASGPPDLRCCLLHQKLQMLNCCIERKKARDEGKKTSASD
VTNIYPGDAGKAGDQLVPDNLKETDKEKGEVGKSWDSWSDSEEEFFECLSDTEELKGNGQ
ESGKKGGPKEMANLRPEGRLYQHGKLTLLHNGEPLYIPVTQEPAPMTEDLLEEQSEVLAK
LGTSAEGAHLRARMQSACLLSDMESFKAANPGCSLEDFVRWYSPRDYIEEEVIDEKGNVV
LKGELSARMKIPSNMWVEAWETAKPIPARRQRRLFDDTREAEKVLHYLAIQKPADLARHL
LPCVIHAAVLKVKEEESLENISSVKKIIKQIISHSSKVLHFPNPEDKKLEEIIHQITNVE
ALIARARSLKAKFGTEKCEQEEEKEDLERFVSCLLEQPEVLVTGAGRGHAGRIIHKLFVN
AQRAAAMTPPEEELKRMGSPEERRQNSVSDFPPPAGREFILRTTVPRPAPYSKALPQRMY
SVLTKEDFRLAGAFSSDTSFF
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgacagtgagcccgaatccgaggtatttgagatcacggacttcaccactgcc
tcggaatgggaaaggtttatttccaaagttgaagaagtcttgaatgactggaaactgatt
ggaaactctttgggaaagccactcgaaaagggtatatttacttctggcacatgggaagag
aaatcagatgaaatttcctttgctgacttcaagttctcagtcactcatcattatcttgta
caagagtccactgataaagaaggaaaggatgagttattagaggatgttgttccacaatct
atgcaagatttgctgggtatgaataatgactttcctccaagagcacattgcctggtaaga
tggtatgggctacgtgagttcgtggtgattgcccctgctgcacacagtgacgctgttctc
agcgaatctaagtgcaaccttcttctgagttctgtttctattgccttgggaaacactggc
tgtcaggtgccactctttgtgcaaattcaccacaaatggcgaagaatgtatgtaggagaa
tgtcaaggtcctggtgtacgaactgatttcgaaatggttcatcttagaaaagtgccaaat
cagtacactcacttatcaggtctgctggatatcttcaaatcaaagattggatgtccttta
actccattgcctccagttagtattgctattcgatttacctatgtacttcaagattggcag
cagtatttttggcctcagcaacctccagacatagatgcccttgtaggaggagaagttgga
ggcttggagtttggcaagttaccatttggtgcctgcgaagatcctattagtgaactccat
ttagctactacatggcctcatctgaccgaagggatcattgtggataatgatgtttattct
gatttggatcctattcaagctccacattggtctgttagagttcgaaaagctgagaatcct
cagtgtttgctaggtgattttgtcactgaattttttaaaatttgccgtcgaaaggagtca
actgatgagattcttggacgatctgcatttgaggaagaaggcaaagaaactgctgatata
actcatgctttgtcaaaattgacagagccggcatcagttccaattcataaattatcagtt
tcaaatatggtacacactgcaaagaagaaaatccgaaaacacagaggtgtagaggagtca
ccgctaaataatgatgttcttaatactattctcctgttcttattccctgatgctgtttct
gagaaaccattagatggaactacttcaacagataataataatcctccatcagagagtgaa
gactataatctctacaatcagttcaagtctgcaccatctgacagtttaacatacaaactg
gctttgtgtctctgtatgatcaatttttaccatggagggttgaaaggagtggcacacctc
tggcaggaatttgttcttgaaatgcgtttccgatgggaaaacaactttctgattccagga
ttagcaagtggacccccagatctgaggtgttgtttactgcatcagaaactacagatgtta
aattgttgtattgaaagaaagaaggcacgtgatgaggggaaaaagacaagtgcttcagat
gtcactaatatatatccaggggatgctggaaaagcaggagaccagttggtgccagataat
ctaaaagaaacagataaggaaaagggagaggtaggaaaatcttgggattcctggagtgac
agcgaagaagaattttttgaatgcctaagtgatactgaagaacttaaaggaaatggacaa
gagagtggcaagaaaggaggacctaaggagatggcaaatttaaggccggaaggacggctc
tatcagcatgggaaacttacactgctgcataatggagaacctctctacattccagtaacc
caggaaccagcacctatgacagaagatctgctagaagagcagtctgaagttttagctaaa
ttaggtacatcggcagagggggctcaccttcgagcacgcatgcagagtgcctgtctgctc
tcagatatggagtcttttaaggcagctaatccaggttgctccctggaagattttgtgagg
tggtattcaccccgggattatattgaagaggaggtgattgatgaaaagggcaatgtggtg
ctgaaaggagaactgagtgcccggatgaagattccaagcaatatgtgggtagaagcctgg
gaaacagctaagccaattcctgctagaaggcaaaggagactctttgatgatacacgggaa
gcagaaaaggtgctgcactatctggcaatccagaaacctgcagaccttgctcggcacctg
ttaccttgtgtgattcatgcagctgtactcaaggtaaaggaagaagaaagtctcgaaaac
atttcttcagttaagaagatcataaagcagataatatcccattccagtaaagttttgcac
ttccccaatccagaagacaagaaattggaagaaatcattcaccagattactaatgtggaa
gctctcattgccagagctcggtcactaaaagccaagtttggaactgagaaatgtgaacag
gaggaggaaaaggaagatcttgaaaggtttgtgagttgcctgctggagcagcctgaagtg
ttagtcaccggtgcaggaagaggacatgctggcaggatcattcacaagctgtttgtgaat
gcccagagggctgcagctatgactccaccagaggaggaattgaagagaatgggctcccca
gaggaaagaaggcagaactccgtgtcagacttcccaccccctgctggccgggaattcatt
ttgcgcaccactgtgccgcgccctgctccctactccaaagctctgcctcagcggatgtac
agtgttctcaccaaagaggactttagacttgcaggtgccttttcatcagatacttccttc
ttctga

DBGET integrated database retrieval system