KEGG   Homo sapiens (human): 22948Help
Entry
22948             CDS       T01001                                 

Gene name
CCT5, CCT-epsilon, CCTE, HEL-S-69, PNAS-102, TCP-1-epsilon
Definition
(RefSeq) chaperonin containing TCP1 subunit 5
  KO
K09497  
T-complex protein 1 subunit epsilon
Organism
hsa  Homo sapiens (human)
Disease
H00265  
Hereditary sensory and autonomic neuropathy (HSAN)
Brite
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   22948 (CCT5)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    22948 (CCT5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22948 (CCT5)
  Exosomal proteins of colorectal cancer cells
   22948 (CCT5)
  Exosomal proteins of bladder cancer cells
   22948 (CCT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15.2
AA seq 541 aa AA seqDB search
MASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKM
MVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEA
EQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNS
CHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMP
KKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLA
ICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQ
EISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVY
GGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRAR
QVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESE
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatggggaccctcgccttcgatgaatatgggcgccctttcctcatcatcaag
gatcaggaccgcaagtcccgtcttatgggacttgaggccctcaagtctcatataatggca
gcaaaggctgtagcaaatacaatgagaacatcacttggaccaaatgggcttgataagatg
atggtggataaggatggagatgtgactgtaactaatgatggggccaccatcttaagcatg
atggatgttgatcatcagattgccaagctgatggtggaactgtccaagtctcaggatgat
gaaattggagatggaaccacaggagtggttgtcctggctggtgccttgttagaagaagcg
gagcaattgctagaccgaggcattcacccaatcagaatagccgatggctatgagcaggct
gctcgtgttgctattgaacacctggacaagatcagcgatagcgtccttgttgacataaag
gacaccgaacccctgattcagacagcaaaaaccacgctgggctccaaagtggtcaacagt
tgtcaccgacagatggctgagattgctgtgaatgccgtcctcactgtagcagatatggag
cggagagacgttgactttgagcttatcaaagtagaaggcaaagtgggcggcaggctggag
gacactaaactgattaagggcgtgattgtggacaaggatttcagtcacccacagatgcca
aaaaaagtggaagatgcgaagattgcaattctcacatgtccatttgaaccacccaaacca
aaaacaaagcataagctggatgtgacctctgtcgaagattataaagcccttcagaaatac
gaaaaggagaaatttgaagagatgattcaacaaattaaagagactggtgctaacctagca
atttgtcagtggggctttgatgatgaagcaaatcacttacttcttcagaacaacttgcct
gcggttcgctgggtaggaggacctgaaattgagctgattgccatcgcaacaggagggcgg
atcgtccccaggttctcagagctcacagccgagaagctgggctttgctggtcttgtacag
gagatctcatttgggacaactaaggataaaatgctggtcatcgagcagtgtaagaactcc
agagctgtaaccatttttattagaggaggaaataagatgatcattgaggaggcgaaacga
tcccttcacgatgctttgtgtgtcatccggaacctcatccgcgataatcgtgtggtgtat
ggaggaggggctgctgagatatcctgtgccctggcagttagccaagaggcggataagtgc
cccaccttagaacagtatgccatgagagcgtttgccgacgcactggaggtcatccccatg
gccctctctgaaaacagtggcatgaatcccatccagactatgaccgaagtccgagccaga
caggtgaaggagatgaaccctgctcttggcatcgactgtttgcacaaggggacaaatgat
atgaagcaacagcatgtcatagaaaccttgattggcaaaaagcaacagatatctcttgca
acacaaatggttagaatgattttgaagattgatgacattcgtaagcctggagaatctgaa
gaatga

DBGET integrated database retrieval system