KEGG   Homo sapiens (human): 2303Help
Entry
2303              CDS       T01001                                 

Gene name
FOXC2, FKHL14, LD, MFH-1, MFH1
Definition
forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Orthology
K09396  
forkhead box protein C
Organism
hsa  Homo sapiens (human)
Disease
H00535  
Lymphedemas
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    2303 (FOXC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q24.1
AA seq 501 aa AA seqDB search
MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYH
HHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSI
RHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEER
AHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGS
PRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPP
LALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSD
HPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQ
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLP
YRSTPPLYRHAAPYSYDCTKY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgcgctactccgtgtccgaccccaacgccctgggagtggtgccctacctgagc
gagcagaattactaccgggctgcgggcagctacggcggcatggccagccccatgggcgtc
tattccggccacccggagcagtacagcgcggggatgggccgctcctacgcgccctaccac
caccaccagcccgcggcgcctaaggacctggtgaagccgccctacagctacatcgcgctc
atcaccatggccatccagaacgcgcccgagaagaagatcaccttgaacggcatctaccag
ttcatcatggaccgcttccccttctaccgggagaacaagcagggctggcagaacagcatc
cgccacaacctctcgctcaacgagtgcttcgtcaaggtgccccgcgacgacaagaagccc
ggcaagggcagttactggaccctggacccggactcctacaacatgttcgagaacggcagc
ttcctgcggcgccggcggcgcttcaaaaagaaggacgtgtccaaggagaaggaggagcgg
gcccacctcaaggagccgcccccggcggcgtccaagggcgccccggccaccccccaccta
gcggacgcccccaaggaggccgagaagaaggtggtgatcaagagcgaggcggcgtccccg
gcgctgccggtcatcaccaaggtggagacgctgagccccgagagcgcgctgcagggcagc
ccgcgcagcgcggcctccacgcccgccggctcccccgacggctcgctgccggagcaccac
gccgcggcgcccaacgggctgcctggcttcagcgtggagaacatcatgaccctgcgaacg
tcgccgccgggcggagagctgagcccgggggccggacgcgcgggcctggtggtgccgccg
ctggcgctgccctacgccgccgcgccgcccgccgcctacggccagccgtgcgctcagggc
ctggaggccggggccgccgggggctaccagtgcagcatgcgagcgatgagcctgtacacc
ggggccgagcggccggcgcacatgtgcgtcccgcccgccctggacgaggccctctcggac
cacccgagcggccccacgtcgcccctgagcgctctcaacctcgccgccggccaggagggc
gcgctcgccgccacgggccaccaccaccagcaccacggccaccaccacccgcaggcgccg
ccgcccccgccggctccccagccccagccgacgccgcagcccggggccgccgcggcgcag
gcggcctcctggtatctcaaccacagcggggacctgaaccacctccccggccacacgttc
gcggcccagcagcaaactttccccaacgtgcgggagatgttcaactcccaccggctgggg
attgagaactcgaccctcggggagtcccaggtgagtggcaatgccagctgccagctgccc
tacagatccacgccgcctctctatcgccacgcagccccctactcctacgactgcacgaaa
tactga

DBGET integrated database retrieval system