KEGG   Homo sapiens (human): 23111Help
Entry
23111             CDS       T01001                                 

Gene name
SPG20, SPARTIN, TAHCCP1
Definition
spastic paraplegia 20 (Troyer syndrome)
Organism
hsa  Homo sapiens (human)
Disease
H00266  
Hereditary spastic paraplegia (SPG)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q13.3
AA seq 666 aa AA seqDB search
MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISIS
SKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPK
DMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAE
GHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVS
APSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTML
QAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQIPGRTRPSSDQ
LKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSEEVNLSHIVPCEPVPEEKPKELPEWS
EKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA
KQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMV
VAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVT
AYNINNIGIKAMVKKTATQTGHTLLEDYQIVDNSQRENQEGAANVNVRGEKDEQTKEVKE
AKKKDK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagagccacaaaatggagaacctgctgaaattaagatcatcagagaagcatat
aagaaggcctttttatttgttaacaaaggtctgaatacagatgaattaggtcagaaggaa
gaagcaaagaactactataagcaaggaataggacacctgctcagagggatcagcatttca
tcaaaagagtctgaacacacaggtcctgggtgggaatctgctagacagatgcaacagaaa
atgaaagaaactctacagaatgtacgcaccaggctggaaattctagagaagggtcttgcc
acttctctgcagaatgatcttcaggaggtgcccaagttatatccagaatttccacctaaa
gacatgtgtgaaaaattaccagagcctcagtcttttagttcagctcctcagcatgctgaa
gtaaatggaaacacctcaactccaagtgcaggggcagttgctgcacctgcttctctgtct
ttaccatcacaaagttgtccagcagaagctcctcctgcttatactcctcaagctgctgaa
ggtcactacactgtatcctatggaacagattctggggagttttcatcagttggagaggag
ttttataggaatcattctcagccaccgcctcttgagaccttagggctggatgcagatgaa
ttgattttgataccaaatggagtacagattttttttgtaaatcctgcaggggaggttagt
gcaccttcgtatcctgggtaccttcgaattgtgaggtttttggataattctctcgatacg
gttctaaaccgtcctcccgggtttcttcaggtttgtgactggttatatcctctagttcct
gatagatctccggttctgaaatgtactgcgggagcctacatgtttcctgatacaatgcta
caagcagcaggatgctttgtgggggtcgtcctgtcctctgagttaccagaggatgataga
gagctctttgaggatctgttaaggcaaatgtctgaccttcggctccaggccaactggaac
agagcagaagaagaaaatgaattccaaatccctggaagaactagaccctcctctgaccaa
ctaaaagaagcctctggcactgatgtgaaacagttggaccaaggcaataaggatgtacgt
cataaaggaaaacgtggaaaaagggctaaagatacttcaagtgaagaagttaacctgagt
cacattgtaccatgtgagccagttccagaagaaaagccaaaagaattacctgaatggagt
gaaaaagtggctcacaacattttgtcaggtgcttcctgggtgagttggggtttagtcaaa
ggtgctgagattactggtaaggcaatccagaaaggtgcttctaaactccgagagcggatt
caaccagaagaaaaacccgtggaagttagtccagctgtcaccaagggactttatatagcg
aagcaagctacaggaggagcagcaaaagtcagtcagttcctggttgatggagtttgcact
gtagcaaattgcgttggaaaagaactagctccacatgtcaagaagcatggaagcaaactt
gttccagaatctcttaaaaaagacaaagatgggaaatctcctctggatggtgctatggtt
gtagcagcaagtagtgttcaaggattttcaactgtctggcaaggattggaatgtgcagct
aaatgcatcgttaacaatgtttcagcagaaactgtacaaactgtcagatacaaatacgga
tataatgcaggagaagctacccaccatgcggtggattctgcggtcaatgttggcgtaact
gcctacaatattaacaacattggtatcaaagcaatggtgaagaaaactgcaacacaaaca
ggacacactctccttgaggactatcagatagttgataattctcagagggaaaatcaagaa
ggagcagcaaatgtcaacgtgagaggggagaaggatgagcagacgaaggaagtaaaggag
gcaaagaagaaagataaatga

DBGET integrated database retrieval system