KEGG   Homo sapiens (human): 2313Help
Entry
2313              CDS       T01001                                 

Gene name
FLI1, EWSR2, SIC-1
Definition
Fli-1 proto-oncogene, ETS transcription factor
Orthology
K09436  
friend leukemia integration 1 transcription factor
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Disease
H00035  
Ewing's sarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2313 (FLI1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2313 (FLI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q24.1-q24.3
AA seq 419 aa AA seqDB search
MTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVG
GGESNPMNYNSYMDEKNGPPPPNMTTNERRVIVPADPTLWTQEHVRQWLEWAIKEYSLME
IDTSFFQNMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSR
LSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNTEQRPQPDPYQILGPTSSRL
ANPGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYD
KLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYHA
HQQKVNFVPPHPSSMPVTSSSFFGAASQYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgactgcctcggggagtcctgactacgggcagccccacaagatcaaccccctcccacca
cagcaggagtggatcaatcagccagtgagggtcaacgtcaagcgggagtatgaccacatg
aatggatccagggagtctccggtggactgcagcgttagcaaatgcagcaagctggtgggc
ggaggcgagtccaaccccatgaactacaacagctatatggacgagaagaatggcccccct
cctcccaacatgaccaccaacgagaggagagtcatcgtccccgcagaccccacactgtgg
acacaggagcatgtgaggcaatggctggagtgggccataaaggagtacagcttgatggag
atcgacacatcctttttccagaacatggatggcaaggaactgtgtaaaatgaacaaggag
gacttcctccgcgccaccaccctctacaacacggaagtgctgttgtcacacctcagttac
ctcagggaaagttcactgctggcctataatacaacctcccacaccgaccaatcctcacga
ttgagtgtcaaagaagacccttcttatgactcagtcagaagaggagcttggggcaataac
atgaattctggcctcaacaaaagtcctccccttggaggggcacaaacgatcagtaagaat
acagagcaacggccccagccagatccgtatcagatcctgggcccgaccagcagtcgccta
gccaaccctggaagcgggcagatccagctgtggcaattcctcctggagctgctctccgac
agcgccaacgccagctgtatcacctgggaggggaccaacggggagttcaaaatgacggac
cccgatgaggtggccaggcgctggggcgagcggaaaagcaagcccaacatgaattacgac
aagctgagccgggccctccgttattactatgataaaaacattatgaccaaagtgcacggc
aaaagatatgcttacaaatttgacttccacggcattgcccaggctctgcagccacatccg
accgagtcgtccatgtacaagtacccttctgacatctcctacatgccttcctaccatgcc
caccagcagaaggtgaactttgtccctccccatccatcctccatgcctgtcacttcctcc
agcttctttggagccgcatcacaatactggacctcccccacggggggaatctaccccaac
cccaacgtcccccgccatcctaacacccacgtgccttcacacttaggcagctactactag

DBGET integrated database retrieval system