KEGG   Homo sapiens (human): 2328Help
Entry
2328              CDS       T01001                                 

Gene name
FMO3, FMOII, TMAU, dJ127D3.1
Definition
flavin containing monooxygenase 3 (EC:1.14.13.8 1.14.13.148)
Orthology
K00485  
dimethylaniline monooxygenase (N-oxide forming) [EC:1.14.13.8]
Organism
hsa  Homo sapiens (human)
Pathway
Drug metabolism - cytochrome P450
Disease
H01234  
Trimethylaminuria (TMAU)
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:hsa00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q24.3
AA seq 532 aa AA seqDB search
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFS
NSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFA
TTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPG
VFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFG
TFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK
PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPL
LEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWP
GARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaagtggccatcattggagctggtgtgagtggcttggcctccatcaggagc
tgtctggaagaggggctggagcccacctgctttgagaagagcaatgacattgggggcctg
tggaaattttcagaccatgcagaggagggcagggctagcatttacaaatcagtcttttcc
aactcttccaaagagatgatgtgtttcccagacttcccatttcccgatgacttccccaac
tttatgcacaacagcaagatccaggaatatatcattgcatttgccaaagaaaagaacctc
ctgaagtacatacaatttaagacatttgtatccagtgtaaataaacatcctgattttgca
actactggccagtgggatgttaccactgaaagggatggtaaaaaagaatcggctgtcttt
gatgctgtaatggtttgttccggacatcatgtgtatcccaacctaccaaaagagtccttt
ccaggactaaaccactttaaaggcaaatgcttccacagcagggactataaagaaccaggt
gtattcaatggaaagcgtgtcctggtggttggcctggggaattcgggctgtgatattgcc
acagaactcagccgcacagcagaacaggtcatgatcagttccagaagtggctcctgggtg
atgagccgggtctgggacaatggttatccttgggacatgctgctcgtcactcgatttgga
accttcctcaagaacaatttaccgacagccatctctgactggttgtacgtgaagcagatg
aatgcaagattcaagcatgaaaactatggcttgatgcctttaaatggagtcctgaggaaa
gagcctgtatttaacgatgagctcccagcaagcattctgtgtggcattgtgtccgtaaag
cctaacgtgaaggaattcacagagacctcggccatttttgaggatgggaccatatttgag
ggcattgactgtgtaatctttgcaacagggtatagttttgcctaccccttccttgatgag
tctatcatcaaaagcagaaacaatgagatcattttatttaaaggagtatttcctcctcta
cttgagaagtcaaccatagcagtgattggctttgtccagtcccttggggctgccattccc
acagttgacctccagtcccgctgggcagcacaagtaataaagggaacttgtactttgcct
tctatggaagacatgatgaatgatattaatgagaaaatggagaaaaagcgcaaatggttt
ggcaaaagcgagaccatacagacagattacattgtttatatggatgaactctcctccttc
attggggcaaagcccaacatcccatggctgtttctcacagatcccaaattggccatggaa
gtttattttggcccttgtagtccctaccagtttaggctggtgggcccagggcagtggcca
ggagccagaaatgccatactgacccagtgggaccggtcgttgaaacccatgcagacacga
gtggtcgggagacttcagaagccttgcttctttttccattggctgaagctctttgcaatt
cctattctgttaatcgctgttttccttgtgttgacctaa

DBGET integrated database retrieval system