KEGG   Homo sapiens (human): 2328Help
Entry
2328              CDS       T01001                                 

Gene name
FMO3, FMOII, TMAU, dJ127D3.1
Definition
flavin containing monooxygenase 3 (EC:1.14.13.8 1.14.13.148)
Orthology
K00485  
dimethylaniline monooxygenase (N-oxide forming) [EC:1.14.13.8]
Organism
hsa  Homo sapiens (human)
Pathway
Drug metabolism - cytochrome P450
Disease
H01234  
Trimethylaminuria (TMAU)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    2328 (FMO3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.8  flavin-containing monooxygenase
     2328 (FMO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q24.3
AA seq 532 aa AA seqDB search
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFS
NSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFA
TTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPG
VFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFG
TFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK
PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPL
LEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWP
GARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaagtggccatcattggagctggtgtgagtggcttggcctccatcaggagc
tgtctggaagaggggctggagcccacctgctttgagaagagcaatgacattgggggcctg
tggaaattttcagaccatgcagaggagggcagggctagcatttacaaatcagtcttttcc
aactcttccaaagagatgatgtgtttcccagacttcccatttcccgatgacttccccaac
tttatgcacaacagcaagatccaggaatatatcattgcatttgccaaagaaaagaacctc
ctgaagtacatacaatttaagacatttgtatccagtgtaaataaacatcctgattttgca
actactggccagtgggatgttaccactgaaagggatggtaaaaaagaatcggctgtcttt
gatgctgtaatggtttgttccggacatcatgtgtatcccaacctaccaaaagagtccttt
ccaggactaaaccactttaaaggcaaatgcttccacagcagggactataaagaaccaggt
gtattcaatggaaagcgtgtcctggtggttggcctggggaattcgggctgtgatattgcc
acagaactcagccgcacagcagaacaggtcatgatcagttccagaagtggctcctgggtg
atgagccgggtctgggacaatggttatccttgggacatgctgctcgtcactcgatttgga
accttcctcaagaacaatttaccgacagccatctctgactggttgtacgtgaagcagatg
aatgcaagattcaagcatgaaaactatggcttgatgcctttaaatggagtcctgaggaaa
gagcctgtatttaacgatgagctcccagcaagcattctgtgtggcattgtgtccgtaaag
cctaacgtgaaggaattcacagagacctcggccatttttgaggatgggaccatatttgag
ggcattgactgtgtaatctttgcaacagggtatagttttgcctaccccttccttgatgag
tctatcatcaaaagcagaaacaatgagatcattttatttaaaggagtatttcctcctcta
cttgagaagtcaaccatagcagtgattggctttgtccagtcccttggggctgccattccc
acagttgacctccagtcccgctgggcagcacaagtaataaagggaacttgtactttgcct
tctatggaagacatgatgaatgatattaatgagaaaatggagaaaaagcgcaaatggttt
ggcaaaagcgagaccatacagacagattacattgtttatatggatgaactctcctccttc
attggggcaaagcccaacatcccatggctgtttctcacagatcccaaattggccatggaa
gtttattttggcccttgtagtccctaccagtttaggctggtgggcccagggcagtggcca
ggagccagaaatgccatactgacccagtgggaccggtcgttgaaacccatgcagacacga
gtggtcgggagacttcagaagccttgcttctttttccattggctgaagctctttgcaatt
cctattctgttaatcgctgttttccttgtgttgacctaa

DBGET integrated database retrieval system