KEGG   Homo sapiens (human): 23529Help
Entry
23529             CDS       T01001                                 

Gene name
CLCF1, BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6
Definition
cardiotrophin-like cytokine factor 1
Orthology
K05421  
B-cell stimulating factor 3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Disease
H00935  
Cold-induced sweating syndrome (CISS) and Crisponi syndrome (CRISPS)
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.3
AA seq 215 aa AA seqDB search
MLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFN
EPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELR
RSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKE
LQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgtgcctgtgcacggtgctctggcacctccctgcagtgccagctctcaatcgc
acaggggacccagggcctggcccctccatccagaaaacctatgacctcacccgctacctg
gagcaccaactccgcagcttggctgggacctatctgaactacctgggcccccctttcaac
gagccagacttcaaccctccccgcctgggggcagagactctgcccagggccactgttgac
ttggaggtgtggcgaagcctcaatgacaaactgcggctgacccagaactacgaggcctac
agccaccttctgtgttacttgcgtggcctcaaccgtcaggctgccactgctgagctgcgc
cgcagcctggcccacttctgcaccagcctccagggcctgctgggcagcattgcgggcgtc
atggcagctctgggctacccactgccccagccgctgcctgggactgaacccacttggact
cctggccctgcccacagtgacttcctccagaagatggacgacttctggctgctgaaggag
ctgcagacctggctgtggcgctcggccaaggacttcaaccggctcaagaagaagatgcag
cctccagcagctgcagtcaccctgcacctgggggctcatggcttctga

DBGET integrated database retrieval system