KEGG   Homo sapiens (human): 2355Help
Entry
2355              CDS       T01001                                 

Gene name
FOSL2, FRA2
Definition
(RefSeq) FOS like 2, AP-1 transcription factor subunit
  KO
K09030  
fos-like antigen 2
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    2355 (FOSL2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    2355 (FOSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23.3
AA seq 326 aa AA seqDB search
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDL
QWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS
PEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKL
EFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDK
AQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESC
SKAHRRSSSSGDQSSDSLNSPTLLAL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaggattatcccgggaactttgacacctcgtcccggggcagcagcggctctcct
gcgcacgccgagtcctactccagcggcggcggcggccagcagaaattccgggtagatatg
cctggctcaggcagtgcattcatccccaccatcaacgccatcacgaccagccaggacctg
cagtggatggtgcagcccacagtgatcacctccatgtccaacccataccctcgctcgcac
ccctacagccccctgccgggcctggcctctgtccctggacacatggccctcccaagacct
ggcgtgatcaagaccattggcaccaccgtgggccgcaggaggagagatgagcagctgtct
cctgaagaggaggagaagcgtcgcatccggcgggagaggaacaagctggctgcagccaag
tgccggaaccgacgccgggagctgacagagaagctgcaggcggagacagaggagctggag
gaggagaagtcaggcctgcagaaggagattgctgagctgcagaaggagaaggagaagctg
gagttcatgttggtggctcacggcccagtgtgcaagattagccccgaggagcgccgatcg
cccccagcccctgggctgcagcccatgcgcagtgggggtggctcggtgggcgctgtagtg
gtgaaacaggagcccctggaagaggacagcccctcgtcctcgtcggcggggctggacaag
gcccagcgctctgtcatcaagcccatcagcattgctgggggcttctacggtgaggagccc
ctgcacacccccatcgtggtgacctccacacctgctgtcactccgggcacctcgaacctc
gtcttcacctatcctagcgtcctggagcaggagtcacccgcatctccctccgaatcctgc
tccaaggctcaccgcagaagcagtagcagcggggaccaatcatcagactccttgaactcc
cccactctgctggctctgtaa

DBGET integrated database retrieval system