KEGG   Homo sapiens (human): 23562Help
Entry
23562             CDS       T01001                                 

Gene name
CLDN14, DFNB29
Definition
claudin 14
Orthology
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Disease
H00605  
Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    23562 (CLDN14)
 Cellular Processes
  Cell communication
   04530 Tight junction
    23562 (CLDN14)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    23562 (CLDN14)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    23562 (CLDN14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   23562 (CLDN14)
  Exosomal proteins of colorectal cancer cells
   23562 (CLDN14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 239 aa AA seqDB search
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTG
IYQCQIYRSLLALPQDLQAARALMVISCLLSGIACACAVIGMKCTRCAKGTPAKTTFAIL
GGTLFILAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTL
LCLSCQDEAPYRPYQAPPRATTTTANTAPAYQPPAAYKDNRAPSVTSATHSGYRLNDYV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacggccgtgcagcttctgggcttcctgctcagcttcctgggcatggtgggc
acgttgatcaccaccatcctgccgcactggcggaggacagcgcacgtgggcaccaacatc
ctcacggccgtgtcctacctgaaagggctctggatggagtgtgtgtggcacagcacaggc
atctaccagtgccagatctaccgatccctgctggcgctgccccaagacctccaggctgcc
cgcgccctcatggtcatctcctgcctgctctcgggcatagcctgcgcctgcgccgtcatc
gggatgaagtgcacgcgctgcgccaagggcacacccgccaagaccacctttgccatcctc
ggcggcaccctcttcatcctggccggcctcctgtgcatggtggccgtctcctggaccacc
aacgacgtggtgcagaacttctacaacccgctgctgcccagcggcatgaagtttgagatt
ggccaggccctgtacctgggcttcatctcctcgtccctctcgctcattggtggcaccctg
ctttgcctgtcctgccaggacgaggcaccctacaggccctaccaggccccgcccagggcc
accacgaccactgcaaacaccgcacctgcctaccagccaccagctgcctacaaagacaat
cgggccccctcagtgacctcggccacgcacagcgggtacaggctgaacgactacgtgtga

DBGET integrated database retrieval system