KEGG   Homo sapiens (human): 23600Help
Entry
23600             CDS       T01001                                 

Gene name
AMACR, AMACRD, CBAS4, RACE, RM
Definition
alpha-methylacyl-CoA racemase (EC:5.1.99.4)
Orthology
K01796  
alpha-methylacyl-CoA racemase [EC:5.1.99.4]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Metabolic pathways
Peroxisome
Module
Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Disease
H00407  
Peroxisomal beta-oxidation enzyme deficiency
H00628  
Congenital bile acid synthesis defect (CBAS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    23600 (AMACR)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    23600 (AMACR)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.4  alpha-methylacyl-CoA racemase
     23600 (AMACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p13
AA seq 394 aa AA seqDB search
MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQP
RGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLA
GHDINYLALSGVLSKIGRSGENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTGKGQVI
DANMVEGTAYLSSFLWKTQKLSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQF
YELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTF
EEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFS
REEIYQLNSDKIIESNKAGSKFWILYPTHSNIQK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcagggcatctcggtcgtggagctgtccggcctggccccgggcccgttctgt
gctatggtcctggctgacttcggggcgcgtgtggtacgcgtggaccggcccggctcccgc
tacgacgtgagccgcttgggccggggcaagcgctcgctagtgctggacctgaagcagccg
cggggagccgccgtgctgcggcgtctgtgcaagcggtcggatgtgctgctggagcccttc
cgccgcggtgtcatggagaaactccagctgggcccagagattctgcagcgggaaaatcca
aggcttatttatgccaggctgagtggatttggccagtcaggaagcttctgccggttagct
ggccacgatatcaactatttggctttgtcaggtgttctctcaaaaattggcagaagtggt
gagaatccgtatgccccgctgaatctcctggctgactttgctggtggtggccttatgtgt
gcactgggcattataatggctctttttgaccgcacacgcactggcaagggtcaggtcatt
gatgcaaatatggtggaaggaacagcatatttaagttcttttctgtggaaaactcagaaa
ttgagtctgtgggaagcacctcgaggacagaacatgttggatggtggagcacctttctat
acgacttacaggacagcagatggggaattcatggctgttggagcaatagaaccccagttc
tacgagctgctgatcaaaggacttggactaaagtctgatgaacttcccaatcagatgagc
atggatgattggccagaaatgaagaagaagtttgcagatgtatttgcagagaagacgaag
gcagagtggtgtcaaatctttgacggcacagatgcctgtgtgactccggttctgactttt
gaggaggttgttcatcatgatcacaacaaggaacggggctcgtttatcaccagtgaggag
caggacgtgagcccccgccctgcacctctgctgttaaacaccccagccatcccttctttc
aaaagggatcctttcataggagaacacactgaggagatacttgaagaatttggattcagc
cgcgaagagatttatcagcttaactcagataaaatcattgaaagtaataaggctggtagc
aagttctggatcttatacccaacacacagcaacatccagaaataa

DBGET integrated database retrieval system