KEGG   Homo sapiens (human): 2538Help
Entry
2538              CDS       T01001                                 

Gene name
G6PC, G6PC1, G6PT, GSD1, GSD1a
Definition
glucose-6-phosphatase, catalytic subunit (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Disease
H00069  
Glycogen storage diseases (GSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2538 (G6PC)
   00052 Galactose metabolism
    2538 (G6PC)
   00500 Starch and sucrose metabolism
    2538 (G6PC)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    2538 (G6PC)
   04151 PI3K-Akt signaling pathway
    2538 (G6PC)
   04152 AMPK signaling pathway
    2538 (G6PC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2538 (G6PC)
   04920 Adipocytokine signaling pathway
    2538 (G6PC)
  Digestive system
   04973 Carbohydrate digestion and absorption
    2538 (G6PC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     2538 (G6PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
17q21
AA seq 357 aa AA seqDB search
MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLSIFQGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK
AQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIV
ASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggaatgaatgttctccatgactttgggatccagtcaacacattacctccag
gtgaattaccaagactcccaggactggttcatcttggtgtccgtgatcgcagacctcagg
aatgccttctacgtcctcttccccatctggttccatcttcaggaagctgtgggcattaaa
ctcctttgggtagctgtgattggagactggctcaacctcgtctttaagtggattctcttt
ggacagcgtccatactggtgggttttggatactgactactacagcaacacttccgtgccc
ctgataaagcagttccctgtaacctgtgagactggaccagggagcccctctggccatgcc
atgggcacagcaggtgtatactacgtgatggtcacatctactctttccatctttcaggga
aagataaagccgacctacagatttcggtgcttgaatgtcattttgtggttgggattctgg
gctgtgcagctgaatgtctgtctgtcacgaatctaccttgctgctcattttcctcatcaa
gttgttgctggagtcctgtcaggcattgctgttgcagaaactttcagccacatccacagc
atctataatgccagcctcaagaaatattttctcattaccttcttcctgttcagcttcgcc
atcggattttatctgctgctcaagggactgggtgtagacctcctgtggactctggagaaa
gcccagaggtggtgcgagcagccagaatgggtccacattgacaccacaccctttgccagc
ctcctcaagaacctgggcacgctctttggcctggggctggctctcaactccagcatgtac
agggagagctgcaaggggaaactcagcaagtggctcccattccgcctcagctctattgta
gcctccctcgtcctcctgcacgtctttgactccttgaaacccccatcccaagtcgagctg
gtcttctacgtcttgtccttctgcaagagtgcggtagtgcccctggcatccgtcagtgtc
atcccctactgcctcgcccaggtcctgggccagccgcacaagaagtcgttgtaa

DBGET integrated database retrieval system