KEGG   Homo sapiens (human): 255738Help
Entry
255738            CDS       T01001                                 

Gene name
PCSK9, FH3, HCHOLA3, LDLCQ1, NARC-1, NARC1, PC9
Definition
proprotein convertase subtilisin/kexin type 9
Orthology
K13050  
proprotein convertase subtilisin/kexin type 9 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Disease
H00155  
Hypercholesterolemia
Drug target
Other: 
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     255738 (PCSK9)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S8: subtilisin family
   255738 (PCSK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32.3
AA seq 692 aa AA seqDB search
MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGT
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLP
GFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLV
EVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAG
VAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAA
CQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVD
LFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA
KDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPD
EELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAP
PAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASC
CHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRD
VSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgtcagctccaggcggtcctggtggccgctgccactgctgctgctgctgctg
ctgctcctgggtcccgcgggcgcccgtgcgcaggaggacgaggacggcgactacgaggag
ctggtgctagccttgcgttccgaggaggacggcctggccgaagcacccgagcacggaacc
acagccaccttccaccgctgcgccaaggatccgtggaggttgcctggcacctacgtggtg
gtgctgaaggaggagacccacctctcgcagtcagagcgcactgcccgccgcctgcaggcc
caggctgcccgccggggatacctcaccaagatcctgcatgtcttccatggccttcttcct
ggcttcctggtgaagatgagtggcgacctgctggagctggccttgaagttgccccatgtc
gactacatcgaggaggactcctctgtctttgcccagagcatcccgtggaacctggagcgg
attacccctccacggtaccgggcggatgaataccagccccccgacggaggcagcctggtg
gaggtgtatctcctagacaccagcatacagagtgaccaccgggaaatcgagggcagggtc
atggtcaccgacttcgagaatgtgcccgaggaggacgggacccgcttccacagacaggcc
agcaagtgtgacagtcatggcacccacctggcaggggtggtcagcggccgggatgccggc
gtggccaagggtgccagcatgcgcagcctgcgcgtgctcaactgccaagggaagggcacg
gttagcggcaccctcataggcctggagtttattcggaaaagccagctggtccagcctgtg
gggccactggtggtgctgctgcccctggcgggtgggtacagccgcgtcctcaacgccgcc
tgccagcgcctggcgagggctggggtcgtgctggtcaccgctgccggcaacttccgggac
gatgcctgcctctactccccagcctcagctcccgaggtcatcacagttggggccaccaat
gcccaagaccagccggtgaccctggggactttggggaccaactttggccgctgtgtggac
ctctttgccccaggggaggacatcattggtgcctccagcgactgcagcacctgctttgtg
tcacagagtgggacatcacaggctgctgcccacgtggctggcattgcagccatgatgctg
tctgccgagccggagctcaccctggccgagttgaggcagagactgatccacttctctgcc
aaagatgtcatcaatgaggcctggttccctgaggaccagcgggtactgacccccaacctg
gtggccgccctgccccccagcacccatggggcaggttggcagctgttttgcaggactgta
tggtcagcacactcggggcctacacggatggccacagccgtcgcccgctgcgccccagat
gaggagctgctgagctgctccagtttctccaggagtgggaagcggcggggcgagcgcatg
gaggcccaagggggcaagctggtctgccgggcccacaacgcttttgggggtgagggtgtc
tacgccattgccaggtgctgcctgctaccccaggccaactgcagcgtccacacagctcca
ccagctgaggccagcatggggacccgtgtccactgccaccaacagggccacgtcctcaca
ggctgcagctcccactgggaggtggaggaccttggcacccacaagccgcctgtgctgagg
ccacgaggtcagcccaaccagtgcgtgggccacagggaggccagcatccacgcttcctgc
tgccatgccccaggtctggaatgcaaagtcaaggagcatggaatcccggcccctcaggag
caggtgaccgtggcctgcgaggagggctggaccctgactggctgcagtgccctccctggg
acctcccacgtcctgggggcctacgccgtagacaacacgtgtgtagtcaggagccgggac
gtcagcactacaggcagcaccagcgaaggggccgtgacagccgttgccatctgctgccgg
agccggcacctggcgcaggcctcccaggagctccagtga

DBGET integrated database retrieval system