KEGG   Homo sapiens (human): 2569Help
Entry
2569              CDS       T01001                                 

Gene name
GABRR1
Definition
gamma-aminobutyric acid (GABA) A receptor, rho 1
Orthology
K05190  
gamma-aminobutyric acid receptor subunit rho
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2569 (GABRR1)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    2569 (GABRR1)
   04723 Retrograde endocannabinoid signaling
    2569 (GABRR1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2569 (GABRR1)
   05033 Nicotine addiction
    2569 (GABRR1)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   2569 (GABRR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q15
AA seq 462 aa AA seqDB search
MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGSPILRRSPDITKSPLTKSEQ
LLRIDDHDFSMRPGFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLSFPS
TNNLSMTFDGRLVKKIWVPDMFFVHSKRSFIHDTTTDNVMLRVQPDGKVLYSLRVTVTAM
CNMDFSRFPLDTQTCSLEIESYAYTEDDLMLYWKKGNDSLKTDERISLSQFLIQEFHTTT
KLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVPLG
ITTVLTMSTIITGVNASMPRVSYIKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQERKEQ
KLREKLPCTSGLPPPRTAMLDGNYSDGEVNDLDNYMPENGEKPDRMMVQLTLASERSSPQ
RKSQRSSYVSMRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgttggctgtcccaaatatgagatttggcatctttcttttgtggtggggatgggttttg
gccactgaaagcagaatgcactggcccggaagagaagtccacgagatgtctaagaaaggc
agcccaattctgagacgaagtcctgacatcaccaaatcgcctctgacaaagtcagaacag
cttctgaggatagatgaccatgatttcagcatgaggcctggctttggaggccctgccatt
cctgttggtgtggatgtgcaggtggagagtttggatagcatctcagaggttgacatggac
tttacgatgaccctctacctgaggcactactggaaggacgagaggctgtcttttccaagc
accaacaacctcagcatgacgtttgacggccggctggtcaagaagatctgggtccctgac
atgtttttcgtgcactccaaacgctccttcatccacgacaccaccacagacaacgtcatg
ttgcgggtccagcctgatgggaaagtgctctatagtctcagggttacagtaactgcaatg
tgcaacatggacttcagccgatttcccttggacacacaaacgtgctctcttgaaattgaa
agctatgcctatacagaagatgacctcatgctgtactggaaaaagggcaatgactcctta
aagacagatgaacggatctcactctcccagttcctcattcaggaattccacaccaccacc
aaactggctttctacagcagcacaggctggtacaaccgtctctacattaatttcacgttg
cgtcgccacatcttcttcttcttgctccaaacttatttccccgctaccctgatggtcatg
ctgtcctgggtgtccttctggatcgaccgcagagccgtgcctgccagagtccccttaggt
atcacaacggtgctgaccatgtccaccatcatcacgggcgtgaatgcctccatgccgcgc
gtctcctacatcaaggccgtggacatctacctctgggtcagctttgtgttcgtgttcctc
tcggtgctggagtatgcggccgtcaactacctgaccactgtgcaggagaggaaggaacag
aagctgcgggagaagcttccctgcaccagcggattacctccgccccgcactgcgatgctg
gacggcaactacagtgatggggaggtgaatgacctggacaactacatgccagagaatgga
gagaagcccgacaggatgatggtgcagctgaccctggcctcagagaggagctccccacag
aggaaaagtcagagaagcagctatgtgagcatgagaatcgacacccacgccattgataaa
tactccaggatcatctttccagcagcatacattttattcaatttaatatactggtctatt
ttctcctag

DBGET integrated database retrieval system