KEGG   Homo sapiens (human): 257Help
Entry
257               CDS       T01001                                 

Gene name
ALX3, FND, FND1
Definition
(RefSeq) ALX homeobox 3
  KO
K09323  
homeobox protein aristaless-like 3
Organism
hsa  Homo sapiens (human)
Disease
H00528  
Frontonasal dysplasia
H00850  
Frontorhiny
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    257 (ALX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p13.3
AA seq 343 aa AA seqDB search
MDPEHCAPFRVGPAPGPYVASGDEPPGPQGTPAAAPHLHPAPPRGPRLTRFPACGPLEPY
LPEPAKPPAKYLQDLGPGPALNGGHFYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSN
LQGSPGPCLASLHLPLSPGLPDSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDV
YAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHP
QLQNSLWASPGSGSPGGPCLVSPEGIPSPCMSPYSHPHGSVAGFMGVPAPSAAHPGIYSI
HGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPPGLLNWTT
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgagcactgcgcgcctttccgcgtggggcctgcacccggcccctatgtggcc
tcgggggacgagcctccgggcccgcagggaacccccgccgctgcgcctcacctgcacccc
gcgccgccccgcggcccgcggctgacccgctttccggcctgcgggcccctggagccctac
ctcccagagccggccaagccgcccgccaagtacctgcaggacctcgggcccggcccggcc
ctcaacggcggccacttctacgagggccccgcggaagctgaggagaagacctccaaagct
gccagcttcccccagctgcccttggactgccgagggggccccagagacgggccctctaac
ttgcaaggctccccaggcccctgcctggccagcctgcatcttcctctttccccgggactc
cctgactccatggagttggccaagaacaagagcaagaagcgtcgtaaccgcacgaccttc
agcacattccagctggaggagctggagaaggtcttccagaaaacccactatcctgatgtg
tatgcccgggagcagctggccctgcgcacagacctgactgaggcccgggtacaggtctgg
ttccagaaccgcagagccaagtggcggaagcgcgagcgttatgggaagatccaggagggg
cggaaccccttcacggctgcctatgacatctctgtgctgccccgtactgacagccaccct
cagctgcagaactccctgtgggccagtccaggatctgggagccctggaggcccctgcctt
gtgtctccagagggcatcccctccccatgcatgtctccatattcccacccccatgggagt
gtggctggcttcatgggggtgccagccccttctgcggctcaccctggcatctactccatc
catggctttccccccaccctggggggccacagctttgagccttcctcagatggtgactat
aagtctccaagcctcgtctcgctcagggtaaagcccaaggagccacccggccttctgaac
tggaccacgtga

DBGET integrated database retrieval system