KEGG   Homo sapiens (human): 26040Help
Entry
26040             CDS       T01001                                 

Gene name
SETBP1, SEB
Definition
SET binding protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00922  
Schinzel-Giedion midface retraction syndrome
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.1
AA seq 242 aa AA seqDB search
MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEE
DELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNL
ENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQ
IKDSSKEEVWKRRGGQGIPFKKQFLSQERAMCFSCPRNPFPAKPGSLTLPFHSEPAVWAQ
EV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggagtccagggaaaccttaagcagctcccggcaaagagggggcgagtcagacttcctg
ccggtctcctcagccaagcccccagctgctcctggctgtgcaggagaacctttgctctcc
actccaggacctgggaaggggatcccggtgggcggagagcgcatggagccagaggaggag
gatgaactaggctcagggcgggatgtggattccaactccaacgcggacagtgagaaatgg
gtggcaggagatggtttggaagagcaggaattttctatcaaggaggcaaacttcacagag
ggaagtctgaagctaaagattcagaccacaaagcgggctaagaaacccccaaagaatttg
gagaactatatatgtccacctgagatcaagatcaccatcaagcagtctggggaccagaag
gtgtcccgtgctggaaaaaatagcaaagccacgaaggaggaagaaagaagccactccaaa
aagaagctcctcacagccagtgaccttgcagccagtgacctcaaaggatttcagccacag
attaaagactccagtaaggaggaagtctggaagagaagaggaggccaaggcatcccattc
aaaaagcaattcctgtcccaggaacgtgccatgtgcttctcatgcccccggaacccattc
cccgcaaaacccggttctctcactcttccttttcacagtgaacctgcagtctgggcacaa
gaagtataa

DBGET integrated database retrieval system