KEGG   Homo sapiens (human): 26053Help
Entry
26053             CDS       T01001                                 

Gene name
AUTS2, FBRSL2, MRD26
Definition
(RefSeq) AUTS2, activator of transcription and developmental regulator
Organism
hsa  Homo sapiens (human)
Disease
H00773  
Autosomal dominant mental retardation
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8WXX7(Tbio)
UniProt: 
Position
7q11.22
AA seq 1259 aa AA seqDB search
MDGPTRGHGLRKKRRSRSQRDRERRSRGGLGAGAAGGGGAGRTRALSLASSSGSDKEDNG
KPPSSAPSRPRPPRRKRRESTSAEEDIIDGFAMTSFVTFEALEKDVALKPQERVEKRQTP
LTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQLKPGQN
SCRDSDSESASGESKGFHRSSSRERLSDSSAPSSLGTGYFCDSDSDQEEKASDASSEKLF
NTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDPCP
QVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQR
PPRPQSPTQLLHQNLPPVQAHPSAQSLSQPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPP
HISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQVA
GHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQ
HTFTPFPHAIPPTAIMPTPAPPMFDKYPTKVDPFYRHSLFHSYPPAVSGIPPMIPPTGPF
GSLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAWQI
YHHQQKVKKQMQSDPHKLDFGLKPEFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHP
TGTPFGPPPHHSNFLNPAAHLEPFNRPSTFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDG
PSVQNFSNPHEPWNRLHRTPPSFPTPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKD
DKERESVEKRHSSHPSPAPVLPVNALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSES
RKDLAADEHKAKEGHLPEKDGHGHEGRAAGEEAKQLARVPSPYVRTPVVESARPNSTSSR
EAEPRKGEPAYENPKKSSEVKVKEERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLA
SMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYR
ELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADRSFRDREPHDYSHHHHHHHHPLSVDPR
REHERGGHLDERERLHMLREDYEHTRLHSVHPASLDGHLPHPSLITPGLPSMHYPRISPT
AGNQNGLLNKTPPTAALSAPPPLISTLGGRPVSPRRTTPLSAEIRERPPSHTLKDIEAR
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atggatggcccgacgcggggccatggactccgcaaaaagcggcggtcgcggtcgcagcga
gaccgggagaggcgctcccggggcgggctgggggccggcgcggccggcggcggcggggct
ggccggacccgggcgctctcactcgcctcgtcgtcgggctccgacaaggaagacaatggg
aagcccccgtcctccgccccgtcccggcccagacccccgcggaggaagcggagagagtcc
acctcggcagaagaggacatcattgatggatttgccatgaccagctttgtcacttttgaa
gcgctggagaaagatgtagcacttaagcctcaggaacgtgtggagaaacgccagacgccc
ctgaccaagaagaaacgagaagcacttaccaatggcttgtcctttcattcaaagaagagc
agactcagccacccacaccactacagctcagatcgagaaaatgaccgcaatctctgccag
caccttgggaagagaaagaaaatgccgaaggcactcagacagctcaagccaggacagaac
agctgcagggacagtgacagtgaaagtgccagtggagaatccaagggcttccaccggagc
agctctcgggaaaggctcagtgatagttcagctccttccagcttgggaacaggctacttc
tgtgacagtgacagtgaccaggaagagaaggcatcagatgccagctctgaaaaactcttc
aacactgttattgtaaacaaagatccggagttaggtgttggcacgctaccagaacatgac
agccaggatgcagggccgattgtccccaagatatcgggtctagagagaagccaggagaag
agccaggactgttgcaaagagccaatctttgagcctgtggtgcttaaagacccctgccct
caggtcgcacagccaataccccagccgcagacggagccccaactccgagctccttctccg
gaccctgacttggtgcagcgcacagaggccccacctcaacccccacctctgagtacacag
ccaccacagggccctcctgaggcccagctccagcctgccccgcagcctcaggtgcagagg
ccacccaggccacagtcccccacccagctgctccatcagaacctcccacctgtgcaggcc
cacccctctgctcagagcctctcccagccattgtcagcctacaacagcagtagcttaagc
ctcaacagtttaagcagcagcagaagcagcactccagcgaagactcagcccgccccacct
cacatctcccaccacccctctgcctccccgttccccctctccctgcccaaccacagcccc
ctgcacagcttcacacccaccctccagccccccgcacactcacatcaccccaatatgttt
gcccctcccactgctctgcctcctccaccaccactgacatcaggaagtctgcaggtggcc
ggacacccggccgggagcacttactcagagcaagacatcttgcgacaggaactgaacact
cgttttttggcctctcagagtgctgaccgcggggcttccctgggccctccgccctacctg
cggaccgagttccatcagcaccagcaccagcaccagcacacccaccagcacacgcaccag
cacaccttcacgccgttcccccacgccatcccacccaccgccatcatgccgacgccagca
cctcccatgtttgacaaataccctacaaaagttgacccattctaccggcacagtctcttc
cattcctatcctcctgcagtgtcgggcatcccccctatgatcccacccactggccctttt
ggttcactacaaggagcatttcagccgaagacatccaaccctatcgatgtcgctgctcgg
cctgggacagtcccacacactttactccaaaaggacccgaggttgacagatcctttcaga
cctatgttaaggaaaccagggaagtggtgtgctatgcatgttcacatcgcctggcagatt
taccaccaccaacagaaagtcaagaaacagatgcagtcagacccacataagctggacttt
ggactgaaacctgagttcctgagccgccctccaggccccagtctttttggagccatccac
cacccccatgacctggcacggccttcaactttgttctctgccgctggtgctgcacaccca
actgggaccccttttgggccacctcctcatcacagcaacttcctcaaccctgctgcccac
ctagagccttttaatcggccgtctacattcacaggcctagcagcagttggtggcaatgcc
ttcgggggacttggaaatccttccgttacacccaactcaatgttcggccacaaggatggc
cccagtgtgcagaactttagcaaccctcacgaaccctggaaccggctgcaccgaacgcct
ccgtcgttcccgacccctccgccctggctgaagccaggggagctggagcgcagcgcgtcc
gctgcagctcatgacagagatagagatgtagataaacgagactcatctgttagtaaagat
gacaaagaaagggaaagcgtcgagaagagacactccagccacccttcaccagcacctgtc
ctcccggtgaatgccctgggacatacccgcagctccactgaacagatccgggctcatctg
aacactgaggctcgggagaaggacaaacccaaagagagggagagagaccactcggaatcc
cgcaaggacctggccgccgacgagcacaaggcgaaagagggccacctgcccgagaaggac
gggcacggccacgaggggcgcgccgcgggcgaagaggccaagcagctggcccgggtgccg
tctccctacgtgcggaccccggtggtggagagtgccaggcccaacagcacctcgagccgg
gaggccgagccgcgcaagggtgagccggcctacgagaaccccaagaagagctccgaggtc
aaggtgaaggaggagcggaaggaagaccatgacctgcctccagaggccccgcagacccac
cgggcctcggagccgccgcctcccaactcctcgtccagcgtgcacccggggcccctggcc
tcgatgcccatgacggtgggggtgacgggcattcaccccatgaacagcatcagcagcctg
gacaggactcgcatgatgacccccttcatgggcatcagccccctcccgggcggagagcgc
ttcccgtacccttctttccactgggaccccatccgggaccccttgagggatccttaccga
gaacttgacattcaccggagagacccgctgggcagggacttcctgctaaggaacgacccg
ctccaccggctctcgactccccggctgtacgaagccgaccgctccttcagggaccgggag
cctcacgactacagccaccaccaccaccaccaccaccacccgctgtctgtggaccctcgg
cgggagcacgagcggggaggccacctggacgagcgggagcgcttgcacatgctcagagaa
gactacgagcacacgcggctccactccgtgcaccccgcctccctcgacggacacctcccc
caccccagcctcatcaccccgggactccccagcatgcactatccccgcatcagccccacc
gcgggcaaccagaacggactcctcaacaagacccctccgacagcagcgctgagcgcacct
cccccgctcatctccacgctggggggccgcccggtctctcccagaaggacgactcctctg
tccgcagagataagggagaggcccccttcccacacgctgaaggatatcgaggcccgataa

DBGET integrated database retrieval system