KEGG   Homo sapiens (human): 26053Help
Entry
26053             CDS       T01001                                 

Gene name
AUTS2, FBRSL2
Definition
autism susceptibility candidate 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.22
AA seq 1235 aa AA seqDB search
MDGPTRGHGLRKKRRSRSQRDRERRSRGGLGAGAAGGGGAGRTRALSLASSSGSDKEDNG
KPPSSAPSRPRPPRRKRRESTSAEEDIIDGFAMTSFVTFEALEKDVALKPQERVEKRQTP
LTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQLKPGQN
SCRDSDSESASGESKGFHRSSSRERLSDSSAPSSLGTGYFCDSDSDQEEKASDASSEKLF
NTVIVNKDPELGVGTLPEHDSQDAGPIVPKISGLERSQEKSQDCCKEPIFEPVVLKDPCP
QVAQPIPQPQTEPQLRAPSPDPDLVQRTEAPPQPPPLSTQPPQGPPEAQLQPAPQPQVQR
PPRPQSPTQLLHQNLPPVQAHPSAQSLSQPLSAYNSSSLSLNSLSSSRSSTPAKTQPAPP
HISHHPSASPFPLSLPNHSPLHSFTPTLQPPAHSHHPNMFAPPTALPPPPPLTSGSLQVA
GHPAGSTYSEQDILRQELNTRFLASQSADRGASLGPPPYLRTEFHQHQHQHQHTHQHTHQ
HTFTPFPHAIPPTAIMPTPAPPMFDKYPTKVDPFYRHSLFHSYPPAVSGIPPMIPPTGPF
GSLQGAFQPKLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFGLKP
EFLSRPPGPSLFGAIHHPHDLARPSTLFSAAGAAHPTGTPFGPPPHHSNFLNPAAHLEPF
NRPSTFTGLAAVGGNAFGGLGNPSVTPNSMFGHKDGPSVQNFSNPHEPWNRLHRTPPSFP
TPPPWLKPGELERSASAAAHDRDRDVDKRDSSVSKDDKERESVEKRHSSHPSPAPVLPVN
ALGHTRSSTEQIRAHLNTEAREKDKPKERERDHSESRKDLAADEHKAKEGHLPEKDGHGH
EGRAAGEEAKQLARVPSPYVRTPVVESARPNSTSSREAEPRKGEPAYENPKKSSEVKVKE
ERKEDHDLPPEAPQTHRASEPPPPNSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDRTR
MMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRL
STPRLYEADRSFRDREPHDYSHHHHHHHHPLSVDPRREHERGGHLDERERLHMLREDYEH
TRLHSVHPASLDGHLPHPSLITPGLPSMHYPRISPTAGNQNGLLNKTPPTAALSAPPPLI
STLGGRPVSPRRTTPLSAEIRERPPSHTLKDIEAR
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atggatggcccgacgcggggccatggactccgcaaaaagcggcggtcgcggtcgcagcga
gaccgggagaggcgctcccggggcgggctgggggccggcgcggccggcggcggcggggct
ggccggacccgggcgctctcactcgcctcgtcgtcgggctccgacaaggaagacaatggg
aagcccccgtcctccgccccgtcccggcccagacccccgcggaggaagcggagagagtcc
acctcggcagaagaggacatcattgatggatttgccatgaccagctttgtcacttttgaa
gcgctggagaaagatgtagcacttaagcctcaggaacgtgtggagaaacgccagacgccc
ctgaccaagaagaaacgagaagcacttaccaatggcttgtcctttcattcaaagaagagc
agactcagccacccacaccactacagctcagatcgagaaaatgaccgcaatctctgccag
caccttgggaagagaaagaaaatgccgaaggcactcagacagctcaagccaggacagaac
agctgcagggacagtgacagtgaaagtgccagtggagaatccaagggcttccaccggagc
agctctcgggaaaggctcagtgatagttcagctccttccagcttgggaacaggctacttc
tgtgacagtgacagtgaccaggaagagaaggcatcagatgccagctctgaaaaactcttc
aacactgttattgtaaacaaagatccggagttaggtgttggcacgctaccagaacatgac
agccaggatgcagggccgattgtccccaagatatcgggtctagagagaagccaggagaag
agccaggactgttgcaaagagccaatctttgagcctgtggtgcttaaagacccctgccct
caggtcgcacagccaataccccagccgcagacggagccccaactccgagctccttctccg
gaccctgacttggtgcagcgcacagaggccccacctcaacccccacctctgagtacacag
ccaccacagggccctcctgaggcccagctccagcctgccccgcagcctcaggtgcagagg
ccacccaggccacagtcccccacccagctgctccatcagaacctcccacctgtgcaggcc
cacccctctgctcagagcctctcccagccattgtcagcctacaacagcagtagcttaagc
ctcaacagtttaagcagcagcagaagcagcactccagcgaagactcagcccgccccacct
cacatctcccaccacccctctgcctccccgttccccctctccctgcccaaccacagcccc
ctgcacagcttcacacccaccctccagccccccgcacactcacatcaccccaatatgttt
gcccctcccactgctctgcctcctccaccaccactgacatcaggaagtctgcaggtggcc
ggacacccggccgggagcacttactcagagcaagacatcttgcgacaggaactgaacact
cgttttttggcctctcagagtgctgaccgcggggcttccctgggccctccgccctacctg
cggaccgagttccatcagcaccagcaccagcaccagcacacccaccagcacacgcaccag
cacaccttcacgccgttcccccacgccatcccacccaccgccatcatgccgacgccagca
cctcccatgtttgacaaataccctacaaaagttgacccattctaccggcacagtctcttc
cattcctatcctcctgcagtgtcgggcatcccccctatgatcccacccactggccctttt
ggttcactacaaggagcatttcagccgaagttgacagatcctttcagacctatgttaagg
aaaccagggaagtggtgtgctatgcatgttcacatcgcctggcagatttaccaccaccaa
cagaaagtcaagaaacagatgcagtcagacccacataagctggactttggactgaaacct
gagttcctgagccgccctccaggccccagtctttttggagccatccaccacccccatgac
ctggcacggccttcaactttgttctctgccgctggtgctgcacacccaactgggacccct
tttgggccacctcctcatcacagcaacttcctcaaccctgctgcccacctagagcctttt
aatcggccgtctacattcacaggcctagcagcagttggtggcaatgccttcgggggactt
ggaaatccttccgttacacccaactcaatgttcggccacaaggatggccccagtgtgcag
aactttagcaaccctcacgaaccctggaaccggctgcaccgaacgcctccgtcgttcccg
acccctccgccctggctgaagccaggggagctggagcgcagcgcgtccgctgcagctcat
gacagagatagagatgtagataaacgagactcatctgttagtaaagatgacaaagaaagg
gaaagcgtcgagaagagacactccagccacccttcaccagcacctgtcctcccggtgaat
gccctgggacatacccgcagctccactgaacagatccgggctcatctgaacactgaggct
cgggagaaggacaaacccaaagagagggagagagaccactcggaatcccgcaaggacctg
gccgccgacgagcacaaggcgaaagagggccacctgcccgagaaggacgggcacggccac
gaggggcgcgccgcgggcgaagaggccaagcagctggcccgggtgccgtctccctacgtg
cggaccccggtggtggagagtgccaggcccaacagcacctcgagccgggaggccgagccg
cgcaagggtgagccggcctacgagaaccccaagaagagctccgaggtcaaggtgaaggag
gagcggaaggaagaccatgacctgcctccagaggccccgcagacccaccgggcctcggag
ccgccgcctcccaactcctcgtccagcgtgcacccggggcccctggcctcgatgcccatg
acggtgggggtgacgggcattcaccccatgaacagcatcagcagcctggacaggactcgc
atgatgacccccttcatgggcatcagccccctcccgggcggagagcgcttcccgtaccct
tctttccactgggaccccatccgggaccccttgagggatccttaccgagaacttgacatt
caccggagagacccgctgggcagggacttcctgctaaggaacgacccgctccaccggctc
tcgactccccggctgtacgaagccgaccgctccttcagggaccgggagcctcacgactac
agccaccaccaccaccaccaccaccacccgctgtctgtggaccctcggcgggagcacgag
cggggaggccacctggacgagcgggagcgcttgcacatgctcagagaagactacgagcac
acgcggctccactccgtgcaccccgcctccctcgacggacacctcccccaccccagcctc
atcaccccgggactccccagcatgcactatccccgcatcagccccaccgcgggcaaccag
aacggactcctcaacaagacccctccgacagcagcgctgagcgcacctcccccgctcatc
tccacgctggggggccgcccggtctctcccagaaggacgactcctctgtccgcagagata
agggagaggcccccttcccacacgctgaaggatatcgaggcccgataa

DBGET integrated database retrieval system