KEGG   Homo sapiens (human): 26058Help
Entry
26058             CDS       T01001                                 

Gene name
GIGYF2, GYF2, PARK11, PERQ2, PERQ3, TNRC15
Definition
(RefSeq) GRB10 interacting GYF protein 2
  KO
K18730  
PERQ amino acid-rich with GYF domain-containing protein
Organism
hsa  Homo sapiens (human)
Disease
H00057  
Parkinson's disease (PD)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     26058 (GIGYF2)
   Surveillance factors
    Other surveillance  factors
     26058 (GIGYF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6Y7W6(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.1
AA seq 1299 aa AA seqDB search
MAAETQTLNFGPEWLRALSSGGSITSPPLSPALPKYKLADYRYGREEMLALFLKDNKIPS
DLLDKEFLPILQEEPLPPLALVPFTEEEQRNFSMSVNSAAVLRLTGRGGGGTVVGAPRGR
SSSRGRGRGRGECGFYQRSFDEVEGVFGRGGGREMHRSQSWEERGDRRFEKPGRKDVGRP
NFEEGGPTSVGRKHEFIRSESENWRIFREEQNGEDEDGGWRLAGSRRDGERWRPHSPDGP
RSAGWREHMERRRRFEFDFRDRDDERGYRRVRSGSGSIDDDRDSLPEWCLEDAEEEMGTF
DSSGAFLSLKKVQKEPIPEEQEMDFRPVDEGEECSDSEGSHNEEAKEPDKTNKKEGEKTD
RVGVEASEETPQTSSSSARPGTPSDHQSQEASQFERKDEPKTEQTEKAEEETRMENSLPA
KVPSRGDEMVADVQQPLSQIPSDTASPLLILPPPVPNPSPTLRPVETPVVGAPGMGSVST
EPDDEEGLKHLEQQAEKMVAYLQDSALDDERLASKLQEHRAKGVSIPLMHEAMQKWYYKD
PQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGRVPFSPGPAPPP
HMGELDQERLTRQQELTALYQMQHLQYQQFLIQQQYAQVLAQQQKAALSSQQQQQLALLL
QQFQTLKMRISDQNIIPSVTRSVSVPDTGSIWELQPTASQPTVWEGGSVWDLPLDTTTPG
PALEQLQQLEKAKAAKLEQERREAEMRAKREEEERKRQEELRRQQEEILRRQQEEERKRR
EEEELARRKQEEALRRQREQEIALRRQREEEERQQQEEALRRLEERRREEEERRKQEELL
RKQEEEAAKWAREEEEAQRRLEENRLRMEEEAARLRHEEEERKRKELEVQRQKELMRQRQ
QQQEALRRLQQQQQQQQLAQMKLPSSSTWGQQSNTTACQSQATLSLAEIQKLEEERERQL
REEQRRQQRELMKALQQQQQQQQQKLSGWGNVSKPSGTTKSLLEIQQEEARQMQKQQQQQ
QQHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWD
DAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNKKVEEEEKLLKLFQGVNKAQDGFTQWCE
QMLHALNTANNLDVPTFVSFLKEVESPYEVHDYIRAYLGDTSEAKEFAKQFLERRAKQKA
NQQRQQQQLPQQQQQQPPQQPPQQPQQQDSVWGMNHSTLHSVFQTNQSNNQQSNFEAVQS
GKKKKKQKMVRADPSLLGFSVNASSERLNMGEIETLDDY
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggaaacgcagacactgaactttgggcctgaatggctccgagctctgtccagt
ggtgggagtattacatcccctcctctttctccagcattgccgaagtataaattagcagat
tatcgttacggcagagaagaaatgttagcacttttccttaaagacaacaagataccttca
gaccttctggataaagaatttctgcctatcctccaggaggaaccccttccaccattggct
ctggtaccctttacagaagaagaacagagaaacttttccatgtctgtaaatagtgctgct
gtcctgcgattgacaggacgaggaggaggaggaacagtggtgggggctcctagaggtcga
agttcttcaagagggcgaggcagaggcagaggtgaatgtggtttctaccaaagaagtttt
gatgaagtagagggtgtttttggtcgaggaggtggcagagaaatgcatagatcgcagagc
tgggaggaaaggggtgacagacgttttgaaaaaccaggacgaaaagatgtagggagacca
aattttgaggaaggtggaccaacatcagtagggagaaagcatgaatttatacgctcagaa
agtgaaaattggcgcatctttagagaggaacaaaatggagaagatgaagatggaggttgg
cgactagctggatcaaggagggatggagagaggtggcgacctcacagtcctgatggccct
cgttctgcaggctggcgggaacacatggaacgacgtcggaggtttgagtttgattttcga
gatagagatgatgaacggggttaccgaagggttcgctctggcagtgggagcatagatgat
gacagggatagcttgcccgaatggtgcttagaggatgctgaagaagaaatgggtacattt
gactcatctggagcattcctttctctaaaaaaagtacagaaagagcctattccagaagag
caggagatggacttccggcctgtggacgaaggggaggagtgctctgactctgagggtagc
cataatgaagaggccaaagaacccgataagacaaataagaaagaaggagagaaaacagat
agagtaggagttgaagctagtgaggaaactccccagacctcatcatcatctgctagacca
ggtactccttcagaccatcagtctcaggaagcatcacagtttgagaggaaagatgaacca
aaaactgagcaaacggaaaaagctgaagaggagactcggatggaaaatagtctaccagcc
aaagtgcccagcagaggggatgaaatggttgctgatgtccagcagcccctgtcgcagatt
ccttcagatacagcctctcctcttctcatacttccacctcctgttcccaatcctagtcct
actctccggccagttgaaacaccagttgtaggtgctcctggtatgggcagtgtttccaca
gaacctgatgatgaagaaggtctcaaacatttggagcagcaagctgagaaaatggtggct
tatctccaagacagtgcactagatgatgaaagattggcatcaaaactgcaagagcacaga
gctaaaggagtgtcgattccattgatgcatgaagcaatgcagaagtggtattacaaagat
cctcagggagaaattcaaggtcccttcaataatcaggagatggcagaatggtttcaggcg
ggctattttactatgtctttattggtgaagagagcgtgtgatgaaagcttccaacctctt
ggcgatatcatgaaaatgtggggaagggttcccttttctccaggtccagctccccctcct
catatgggagagctggaccaggaacgactgaccaggcagcaagaactcacagccttatac
cagatgcagcacctgcagtaccagcagtttttaatacaacaacaatatgcacaggttttg
gcccaacagcagaaagcagcactgtcttcccagcagcagcagcagttggcacttcttctt
caacagtttcagaccttgaagatgagaatatctgatcagaacatcattccctcagtaact
aggtctgtgtccgtgccagatactggctctatctgggagcttcagccaacagcttcacag
cctacagtttgggaaggtggtagtgtatgggatcttcctctggacaccacgacaccaggc
cctgccctggaacagcttcagcagctagagaaggccaaagctgcaaagctagagcaagag
agaagagaggcagaaatgagggcaaaacgggaagaggaagagcgaaagaggcaggaagaa
ctccgaagacaacaggaggaaattcttcggcgacagcaggaagaagaaaggaaaaggcga
gaggaagaagaacttgcccgaaggaaacaggaagaggctctgcgtcgccagcgggagcaa
gaaattgcattaaggcgacagcgagaagaggaagaaagacagcagcaagaagaagctctt
agaagactggaagagaggagaagagaagaggaagaaaggcggaagcaggaagaattgtta
cgcaaacaggaagaggaggctgcaaaatgggcccgggaagaagaagaagcccagcgtcga
ttagaggagaaccggctgcggatggaagaggaggcagccagactccggcatgaggaagaa
gaacggaagagaaaggagctggaggtccagcggcagaaggagttaatgcgccagaggcag
cagcagcaagaggctctccggaggttgcagcagcagcagcagcaacaacagctggcgcag
atgaagcttccttcttcttcaacgtggggccagcagtccaatacaacagcatgtcagtcc
caggccacgctgtcgttggctgaaatccaaaaactagaggaagaacgagaacggcagctt
cgagaagagcaaaggcgccagcagagggagttgatgaaagctcttcagcagcagcagcaa
cagcaacagcagaaactctcaggttgggggaatgtcagcaaaccttcaggtaccacgaaa
tctcttctggagatccagcaggaagaggccaggcaaatgcaaaagcagcagcagcagcag
cagcaacaccagcaaccaaacagagctcgtaacaatacgcattccaacctgcacaccagc
attgggaattctgtttggggctctataaatactggtcctcctaaccagtgggcatctgac
ctagtcagtagtatttggagtaatgctgacactaaaaactccaacatgggattctgggat
gatgcagtgaaagaggtgggacctaggaattcaacaaataaaaataaaaacaacgccagt
ctcagtaaatctgtaggtgtgtctaaccggcagaataagaaagtagaagaagaagaaaag
ttgctgaagctctttcagggagtaaataaagcccaagatggatttacgcagtggtgtgaa
cagatgcttcatgcccttaatacggcaaataacttggatgttcccacatttgtttctttc
ctgaaagaagtagaatctccttatgaggtccatgattatatcagggcctatttaggagat
acttctgaggccaaggagtttgccaagcagttccttgagcgccgtgccaaacagaaagcc
aaccagcagcgtcagcagcagcagctgccacagcagcagcagcagcagccgccacagcag
ccgccacagcagccacaacagcaggactctgtgtgggggatgaaccacagtacactccat
tcagtatttcagaccaatcaaagcaacaaccaacaatccaattttgaggctgtgcagagt
ggcaagaagaagaaaaagcagaagatggtccgagcagatcccagtttattaggattttca
gtcaatgcatcatcggagcgactcaacatgggtgaaatcgagacgttggatgactactga

DBGET integrated database retrieval system