KEGG   Homo sapiens (human): 26128Help
Entry
26128             CDS       T01001                                 

Gene name
KIF1BP, KBP, KIAA1279, TTC20
Definition
(RefSeq) KIF1 binding protein
Organism
hsa  Homo sapiens (human)
Disease
H00271  
Polymicrogyria
H00936  
Goldberg-Shprintzen megacolon syndrome
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.1
AA seq 621 aa AA seqDB search
MANVPWAEVCEKFQAALALSRVELHKNPEKEPYKSKYSARALLEEVKALLGPAPEDEDER
PEAEDGPGAGDHALGLPAEVVEPEGPVAQRAVRLAVIEFHLGVNHIDTEELSAGEEHLVK
CLRLLRRYRLSHDCISLCIQAQNNLGILWSEREEIETAQAYLESSEALYNQYMKEVGSPP
LDPTERFLPEEEKLTEQERSKRFEKVYTHNLYYLAQVYQHLEMFEKAAHYCHSTLKRQLE
HNAYHPIEWAINAATLSQFYINKLCFMEARHCLSAANVIFGQTGKISATEDTPEAEGEVP
ELYHQRKGEIARCWIKYCLTLMQNAQLSMQDNIGELDLDKQSELRALRKKELDEEESIRK
KAVQFGTGELCDAISAVEEKVSYLRPLDFEEARELFLLGQHYVFEAKEFFQIDGYVTDHI
EVVQDHSALFKVLAFFETDMERRCKMHKRRIAMLEPLTVDLNPQYYLLVNRQIQFEIAHA
YYDMMDLKVAIADRLRDPDSHIVKKINNLNKSALKYYQLFLDSLRDPNKVFPEHIGEDVL
RPAMLAKFRVARLYGKIITADPKKELENLATSLEHYKFIVDYCEKHPEAAQEIEVELELS
KEMVSLLPTKMERFRTKMALT
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgttccgtgggcagaggtctgcgagaaattccaggcggcgctcgctctgtcg
cgggtggaactgcataaaaatccggagaaggaaccatacaagtccaaatacagcgcccgg
gcgctactggaagaggtcaaggcgctgctcggccctgcgcctgaggacgaggatgagcgg
cctgaggccgaggacggcccgggtgccggtgaccacgccctggggctgccggctgaggtg
gtggagcccgaggggcccgtcgcccagcgagcggtgaggctggcagtcatcgagttccac
ctcggggtgaaccacatcgacacggaggagctgtcggcgggggaggagcacctggtgaaa
tgcctgcggctgctgcgcaggtaccggctctcgcacgactgcatctctctctgcatccag
gcgcagaataacctgggtatcttgtggtctgaaagagaagaaattgaaactgcacaggct
tacctagagtcatcagaagcactatataatcagtatatgaaagaggttgggagtcctcct
cttgatcctactgagcgttttcttcctgaagaagagaaacttactgaacaagagagatca
aaaagatttgaaaaggtttatactcataacctatattacctagctcaagtctaccagcat
ctggaaatgtttgagaaggctgctcactattgccatagtacactaaaacgccagcttgag
cacaatgcctaccatcctatagagtgggctatcaatgctgctaccttgtcacagttttac
atcaataagctatgctttatggaggccaggcactgtttatcagctgctaatgtcattttt
ggtcaaactggaaagatctcagccacagaagacactcctgaagctgaaggagaagtgcca
gagctttatcatcaaagaaagggggaaatagcaaggtgctggatcaaatactgtttgact
ctcatgcagaatgcccaactctccatgcaggacaacataggagagcttgatcttgataaa
cagtctgaacttagagctttaaggaaaaaagaactagatgaggaggaaagcattcggaaa
aaagctgtgcagtttggaaccggtgaactgtgtgatgccatctctgcagtagaagagaaa
gtgagctacttgagacctttagattttgaagaagccagagaacttttcttattgggtcag
cactatgtctttgaggcaaaagagttctttcagattgatggttatgtcactgaccatatt
gaagttgtccaagaccacagtgctctgtttaaggtgcttgcattctttgaaactgacatg
gagagacggtgcaagatgcataaacgcagaatagccatgctagagcccctaactgtagac
ctgaatccacagtattatctgttggtcaacagacagatccagtttgaaattgcacatgct
tactatgatatgatggatttgaaggttgccattgctgacaggctaagggatcctgattca
cacattgtaaaaaaaataaataatcttaataagtcagcactgaagtactaccagctcttc
ttagactccctgagagacccaaataaagtattccctgagcatataggggaagatgttctt
cgccctgccatgttagctaagtttcgagttgcccgtctctatggcaaaatcattactgca
gatcccaagaaagagctggaaaatttggcaacatcattggaacattacaaatttattgtt
gattactgtgaaaagcatcctgaggccgcccaggaaatagaagttgagctagaacttagt
aaagagatggttagtcttctcccaacaaaaatggagagattcagaaccaagatggccctg
acttaa

DBGET integrated database retrieval system