KEGG   Homo sapiens (human): 26503Help
Entry
26503             CDS       T01001                                 

Gene name
SLC17A5, AST, ISSD, NSD, SD, SIALIN, SIASD, SLD
Definition
solute carrier family 17 (acidic sugar transporter), member 5
Orthology
K12301  
MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H00147  
Sialuria/ Sialic acid storage disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    26503 (SLC17A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q13
AA seq 495 aa AA seqDB search
MRSPVRDLARNDGEESTDRTPLLPGAPRAEAAPVCCSARYNLAILAFFGFFIVYALRVNL
SVALVDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYI
ITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFP
AMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYYMNWTYVFYFFGTIGIFW
FLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLSSQKSVPWVPILKSLPLWAIVVAHFS
YNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFST
LCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPS
YAGILLGITNTFATIPGMVGPVIAKSLTPDNTVGEWQTVFYIAAAINVFGAIFFTLFAKG
EVQNWALNDHHGHRH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctccggttcgagacctggcccggaacgatggcgaggagagcacggaccgcacg
cctcttctaccgggcgccccacgggccgaagccgctccagtgtgctgctctgctcgttac
aacttagcaattttggccttttttggtttcttcattgtgtatgcattacgtgtgaatctg
agtgttgcgttagtggatatggtagattcaaatacaactttagaagataatagaacttcc
aaggcgtgtccagagcattctgctcccataaaagttcatcataatcaaacgggtaagaag
taccaatgggatgcagaaactcaaggatggattctcggttcctttttttatggctacatc
atcacacagattcctggaggatatgttgccagcaaaataggggggaaaatgctgctagga
tttgggatccttggcactgctgtcctcaccctgttcactcccattgctgcagatttagga
gttggaccactcattgtactcagagcactagaaggactaggagagggtgttacatttcca
gccatgcatgccatgtggtcttcttgggctccccctcttgaaagaagcaaacttcttagc
atttcatatgcaggagcacagcttgggacagtaatttctcttcctctttctggaataatt
tgctactatatgaattggacttatgtcttctacttttttggtactattggaatattttgg
tttcttttgtggatctggttagttagtgacacaccacaaaaacacaagagaatttcccat
tatgaaaaggaatacattctttcatcattaagaaatcagctttcttcacagaagtcagtg
ccgtgggtacccattttaaaatccctgccactttgggctatcgtagttgcacacttttct
tacaactggactttttatactttattgacattattgcctacttatatgaaggagatccta
aggttcaatgttcaagagaatgggtttttatcttcattgccttatttaggctcttggtta
tgtatgatcctgtctggtcaagctgctgacaatttaagggcaaaatggaatttttcaact
ttatgtgttcgcagaatttttagccttataggaatgattggacctgcagtattcctggta
gctgctggcttcattggctgtgattattctttggccgttgctttcctaactatatcaaca
acactgggaggcttttgctcttctggatttagcatcaaccatctggatattgctccttcg
tatgctggtatcctcctgggcatcacaaatacatttgccactattccaggaatggttggg
cccgtcattgctaaaagtctgacccctgataacactgttggagaatggcaaaccgtgttc
tatattgctgctgctattaatgtttttggtgccattttctttacactattcgccaaaggt
gaagtacaaaactgggctctcaatgatcaccatggacacagacactga

DBGET integrated database retrieval system