KEGG   Homo sapiens (human): 26584Help
Entry
26584             CDS       T01001                                 

Gene name
DUX1
Definition
(RefSeq) double homeobox 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox Homeobox_KN HTH_26
Motif
Other DBs
NCBI-GeneID: 26584
NCBI-ProteinID: NP_036278
OMIM: 611441
HGNC: 3079
Pharos: Q96PT3(Tdark) O43812(Tdark)
UniProt: O43812 Q96PT3
Position
10
AA seq 170 aa AA seqDB search
MALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLYPGIATKEELAQGIDIPE
PRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAFEKDRFPG
IAAREELARETGLPESRIQIWFQNRRARHRGQSGRAPTQASIRCNAAPIG
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggccctcctgacagctttggacgacaccctccccgaggaagcccagggaccgggaagg
cgaatgatactcctttcgaccccgagtcaaagtgatgccctgcgagcctgctttgagcgg
aacctgtacccgggcattgccaccaaagaagagctggcccagggcatcgacattccggag
cccagggtccagatttggtttcagaatgagagatcatgccagttgaggcagcaccggcgg
caatctcggccctggcccgggagacgtgacccgcaaaaaggcagacgaaagcggactgcc
atcaccggatcccaaaccgccctgctcctccgagcctttgagaaggatcgctttccaggc
attgctgccagggaagagctggccagagagacgggcctcccggagtccaggattcagatc
tggtttcagaatcgaagagccaggcaccggggacagtctggcagggcgcccacgcaggca
agcatccggtgcaatgcagccccaattgggtga

DBGET integrated database retrieval system