KEGG   Homo sapiens (human): 26608Help
Entry
26608             CDS       T01001                                 

Gene name
TBL2, WBSCR13, WS-betaTRP
Definition
(RefSeq) transducin beta like 2
Organism
hsa  Homo sapiens (human)
Disease
H01439  Williams-Beuren syndrome
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A FdsD RMI1_C
Motif
Other DBs
NCBI-GeneID: 26608
NCBI-ProteinID: NP_036585
OMIM: 605842
HGNC: 11586
Ensembl: ENSG00000106638
Vega: OTTHUMG00000023427
Pharos: Q9Y4P3(Tbio)
UniProt: Q9Y4P3
Position
7q11.23
AA seq 447 aa AA seqDB search
MELSQMSELMGLSVLLGLLALMATAAVARGWLRAGEERSGRPACQKANGFPPDKSSGSKK
QKQYQRIRKEKPQQHNFTHRLLAAALKSHSGNISCMDFSSNGKYLATCADDRTIRIWSTK
DFLQREHRSMRANVELDHATLVRFSPDCRAFIVWLANGDTLRVFKMTKREDGGYTFTATP
EDFPKKHKAPVIDIGIANTGKFIMTASSDTTVLIWSLKGQVLSTINTNQMNNTHAAVSPC
GRFVASCGFTPDVKVWEVCFGKKGEFQEVVRAFELKGHSAAVHSFAFSNDSRRMASVSKD
GTWKLWDTDVEYKKKQDPYLLKTGRFEEAAGAAPCRLALSPNAQVLALASGSSIHLYNTR
RGEKEECFERVHGECIANLSFDITGRFLASCGDRAVRLFHNTPGHRAMVEEMQGHLKRAS
NESTRQRLQQQLTQAQETLKSLGALKK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggagctctcgcagatgtcggagctcatggggctgtcggtgttgcttgggctgctggcc
ctgatggcgacggcggcggtagcgcgggggtggctgcgcgcgggggaggagaggagcggc
cggcccgcctgccaaaaagcaaatggatttccacctgacaaatcttcgggatccaagaag
cagaaacaatatcagcggattcggaaggagaagcctcaacaacacaacttcacccaccgc
ctcctggctgcagctctgaagagccacagcgggaacatatcttgcatggactttagcagc
aatggcaaatacctggctacctgtgcagatgatcgcaccatccgcatctggagcaccaag
gacttcctgcagcgagagcaccgcagcatgagagccaacgtggagctggaccacgccacc
ctggtgcgcttcagccctgactgcagagccttcatcgtctggctggccaacggggacacc
ctccgtgtcttcaagatgaccaagcgggaggatgggggctacaccttcacagccacccca
gaggacttccctaaaaagcacaaggcgcctgtcatcgacattggcattgctaacacaggg
aagtttatcatgactgcctccagtgacaccactgtcctcatctggagcctgaagggtcaa
gtgctgtctaccatcaacaccaaccagatgaacaacacacacgctgctgtatctccctgt
ggcagatttgtagcctcgtgtggcttcaccccagatgtgaaggtttgggaagtctgcttt
ggaaagaagggggagttccaggaggtggtgcgagccttcgaactaaagggccactccgcg
gctgtgcactcgtttgctttctccaacgactcacggaggatggcttctgtctccaaggat
ggtacatggaaactgtgggacacagatgtggaatacaagaagaagcaggacccctacttg
ctgaagacaggccgctttgaagaggcggcgggtgccgcgccgtgccgcctggccctctcc
cccaacgcccaggtcttggccttggccagtggcagtagtattcatctctacaatacccgg
cggggcgagaaggaggagtgctttgagcgggtccatggcgagtgtatcgccaacttgtcc
tttgacatcactggccgctttctggcctcctgtggggaccgggcggtgcggctgtttcac
aacactcctggccaccgagccatggtggaggagatgcagggccacctgaagcgggcctcc
aacgagagcacccgccagaggctgcagcagcagctgacccaggcccaagagaccctgaag
agcctgggtgccctgaagaagtga

DBGET integrated database retrieval system