KEGG   Homo sapiens (human): 2670Help
Entry
2670              CDS       T01001                                 

Gene name
GFAP
Definition
glial fibrillary acidic protein
Orthology
K05640  
glial fibrillary acidic protein
Organism
hsa  Homo sapiens (human)
Disease
H00065  
Alexander disease
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 431 aa AA seqDB search
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRGGKSTKDGENHKVTRYLKSLTIRVIPIQAH
QIVNGTPPARG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggagaggagacgcatcacctccgctgctcgccgctcctacgtctcctcaggggagatg
atggtggggggcctggctcctggccgccgtctgggtcctggcacccgcctctccctggct
cgaatgccccctccactcccgacccgggtggatttctccctggctggggcactcaatgct
ggcttcaaggagacccgggccagtgagcgggcagagatgatggagctcaatgaccgcttt
gccagctacatcgagaaggttcgcttcctggaacagcaaaacaaggcgctggctgctgag
ctgaaccagctgcgggccaaggagcccaccaagctggcagacgtctaccaggctgagctg
cgagagctgcggctgcggctcgatcaactcaccgccaacagcgcccggctggaggttgag
agggacaatctggcacaggacctggccactgtgaggcagaagctccaggatgaaaccaac
ctgaggctggaagccgagaacaacctggctgcctatagacaggaagcagatgaagccacc
ctggcccgtctggatctggagaggaagattgagtcgctggaggaggagatccggttcttg
aggaagatccacgaggaggaggttcgggaactccaggagcagctggcccgacagcaggtc
catgtggagcttgacgtggccaagccagacctcaccgcagccctgaaagagatccgcacg
cagtatgaggcaatggcgtccagcaacatgcatgaagccgaagagtggtaccgctccaag
tttgcagacctgacagacgctgctgcccgcaacgcggagctgctccgccaggccaagcac
gaagccaacgactaccggcgccagttgcagtccttgacctgcgacctggagtctctgcgc
ggcacgaacgagtccctggagaggcagatgcgcgagcaggaggagcggcacgtgcgggag
gcggccagttatcaggaggcgctggcgcggctggaggaagaggggcagagcctcaaggac
gagatggcccgccacttgcaggagtaccaggacctgctcaatgtcaagctggccctggac
atcgagatcgccacctacaggaagctgctagagggcgaggagaaccggatcaccattccc
gtgcagaccttctccaacctgcagattcgagggggcaaaagcaccaaagacggggaaaat
cacaaggtcacaagatatctcaaaagcctcacaatacgagttataccaatacaggctcac
cagattgtaaatggaacgccgccggctcgcggttag

DBGET integrated database retrieval system