KEGG   Homo sapiens (human): 2670Help
Entry
2670              CDS       T01001                                 

Gene name
GFAP, ALXDRD
Definition
(RefSeq) glial fibrillary acidic protein
  KO
K05640  
glial fibrillary acidic protein
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Disease
H00065  
Alexander disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    2670 (GFAP)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     2670 (GFAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 432 aa AA seqDB search
MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggagaggagacgcatcacctccgctgctcgccgctcctacgtctcctcaggggagatg
atggtggggggcctggctcctggccgccgtctgggtcctggcacccgcctctccctggct
cgaatgccccctccactcccgacccgggtggatttctccctggctggggcactcaatgct
ggcttcaaggagacccgggccagtgagcgggcagagatgatggagctcaatgaccgcttt
gccagctacatcgagaaggttcgcttcctggaacagcaaaacaaggcgctggctgctgag
ctgaaccagctgcgggccaaggagcccaccaagctggcagacgtctaccaggctgagctg
cgagagctgcggctgcggctcgatcaactcaccgccaacagcgcccggctggaggttgag
agggacaatctggcacaggacctggccactgtgaggcagaagctccaggatgaaaccaac
ctgaggctggaagccgagaacaacctggctgcctatagacaggaagcagatgaagccacc
ctggcccgtctggatctggagaggaagattgagtcgctggaggaggagatccggttcttg
aggaagatccacgaggaggaggttcgggaactccaggagcagctggcccgacagcaggtc
catgtggagcttgacgtggccaagccagacctcaccgcagccctgaaagagatccgcacg
cagtatgaggcaatggcgtccagcaacatgcatgaagccgaagagtggtaccgctccaag
tttgcagacctgacagacgctgctgcccgcaacgcggagctgctccgccaggccaagcac
gaagccaacgactaccggcgccagttgcagtccttgacctgcgacctggagtctctgcgc
ggcacgaacgagtccctggagaggcagatgcgcgagcaggaggagcggcacgtgcgggag
gcggccagttatcaggaggcgctggcgcggctggaggaagaggggcagagcctcaaggac
gagatggcccgccacttgcaggagtaccaggacctgctcaatgtcaagctggccctggac
atcgagatcgccacctacaggaagctgctagagggcgaggagaaccggatcaccattccc
gtgcagaccttctccaacctgcagattcgagaaaccagcctggacaccaagtctgtgtca
gaaggccacctcaagaggaacatcgtggtgaagaccgtggagatgcgggatggagaggtc
attaaggagtccaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system