KEGG   Homo sapiens (human): 2683Help
Entry
2683              CDS       T01001                                 

Gene name
B4GALT1, B4GAL-T1, CDG2D, GGTB2, GT1, GTB, beta4Gal-T1
Definition
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 (EC:2.4.1.22 2.4.1.90 2.4.1.38)
Orthology
K07966  
beta-1,4-galactosyltransferase 1 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Galactose metabolism
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
N-glycan biosynthesis, complex type
Disease
H00119  
Congenital disorders of glycosylation (CDG) type II
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    2683 (B4GALT1)
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    2683 (B4GALT1)
   00514 Other types of O-glycan biosynthesis
    2683 (B4GALT1)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    2683 (B4GALT1)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    2683 (B4GALT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     2683 (B4GALT1)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     2683 (B4GALT1)
    2.4.1.90  N-acetyllactosamine synthase
     2683 (B4GALT1)
    2.4.1.-  
     2683 (B4GALT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   2683 (B4GALT1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2683 (B4GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13
AA seq 398 aa AA seqDB search
MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPL
QGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVP
HTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAI
IIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYD
YTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTI
NGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIA
HTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttcgggagccgctcctgagcggcagcgccgcgatgccaggcgcgtccctacag
cgggcctgccgcctgctcgtggccgtctgcgctctgcaccttggcgtcaccctcgtttac
tacctggctggccgcgacctgagccgcctgccccaactggtcggagtctccacaccgctg
cagggcggctcgaacagtgccgccgccatcgggcagtcctccggggagctccggaccgga
ggggcccggccgccgcctcctctaggcgcctcctcccagccgcgcccgggtggcgactcc
agcccagtcgtggattctggccctggccccgctagcaacttgacctcggtcccagtgccc
cacaccaccgcactgtcgctgcccgcctgccctgaggagtccccgctgcttgtgggcccc
atgctgattgagtttaacatgcctgtggacctggagctcgtggcaaagcagaacccaaat
gtgaagatgggcggccgctatgcccccagggactgcgtctctcctcacaaggtggccatc
atcattccattccgcaaccggcaggagcacctcaagtactggctatattatttgcaccca
gtcctgcagcgccagcagctggactatggcatctatgttatcaaccaggcgggagacact
atattcaatcgtgctaagctcctcaatgttggctttcaagaagccttgaaggactatgac
tacacctgctttgtgtttagtgacgtggacctcattccaatgaatgaccataatgcgtac
aggtgtttttcacagccacggcacatttccgttgcaatggataagtttggattcagccta
ccttatgttcagtattttggaggtgtctctgctctaagtaaacaacagtttctaaccatc
aatggatttcctaataattattggggctggggaggagaagatgatgacatttttaacaga
ttagtttttagaggcatgtctatatctcgcccaaatgctgtggtcgggaggtgtcgcatg
atccgccactcaagagacaagaaaaatgaacccaatcctcagaggtttgaccgaattgca
cacacaaaggagacaatgctctctgatggtttgaactcactcacctaccaggtgctggat
gtacagagatacccattgtatacccaaatcacagtggacatcgggacaccgagctag

DBGET integrated database retrieval system