KEGG   Homo sapiens (human): 26986Help
Entry
26986             CDS       T01001                                 

Gene name
PABPC1, PAB1, PABP, PABP1, PABPC2, PABPL1
Definition
(RefSeq) poly(A) binding protein cytoplasmic 1
  KO
K13126  
polyadenylate-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    26986 (PABPC1)
   03015 mRNA surveillance pathway
    26986 (PABPC1)
  Folding, sorting and degradation
   03018 RNA degradation
    26986 (PABPC1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     26986 (PABPC1)
   mRNA cycle factors
    Stress granule specific factors
     26986 (PABPC1)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    26986 (PABPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q22.2-q23
AA seq 636 aa AA seqDB search
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccagtgcccccagctaccccatggcctcgctctacgtgggggacctccacccc
gacgtgaccgaggcgatgctctacgagaagttcagcccggccgggcccatcctctccatc
cgggtctgcagggacatgatcacccgccgctccttgggctacgcgtatgtgaacttccag
cagccggcggacgcggagcgtgctttggacaccatgaattttgatgttataaagggcaag
ccagtacgcatcatgtggtctcagcgtgatccatcacttcgcaaaagtggagtaggcaac
atattcattaaaaatctggacaaatccattgataataaagcactgtatgatacattttct
gcttttggtaacatcctttcatgtaaggtggtttgtgatgaaaatggttccaagggctat
ggatttgtacactttgagacgcaggaagcagctgaaagagctattgaaaaaatgaatgga
atgctcctaaatgatcgcaaagtatttgttggacgatttaagtctcgtaaagaacgagaa
gctgaacttggagctagggcaaaagaattcaccaatgtttacatcaagaattttggagaa
gacatggatgatgagcgccttaaggatctctttggcaagtttgggcctgccttaagtgtg
aaagtaatgactgatgaaagtggaaaatccaaaggatttggatttgtaagctttgaaagg
catgaagatgcacagaaagctgtggatgagatgaacggaaaggagctcaatggaaaacaa
atttatgttggtcgagctcagaaaaaggtggaacggcagacggaacttaagcgcaaattt
gaacagatgaaacaagataggatcaccagataccagggtgttaatctttatgtgaaaaat
cttgatgatggtattgatgatgaacgtctccggaaagagttttctccatttggtacaatc
actagtgcaaaggttatgatggagggtggtcgcagcaaagggtttggttttgtatgtttc
tcctccccagaagaagccactaaagcagttacagaaatgaacggtagaattgtggccaca
aagccattgtatgtagctttagctcagcgcaaagaagagcgccaggctcacctcactaac
cagtatatgcagagaatggcaagtgtacgagctgttcccaaccctgtaatcaacccctac
cagccagcacctccttcaggttacttcatggcagctatcccacagactcagaaccgtgct
gcatactatcctcctagccaaattgctcaactaagaccaagtcctcgctggactgctcag
ggtgccagacctcatccattccaaaatatgcccggtgctatccgcccagctgctcctaga
ccaccatttagtactatgagaccagcttcttcacaggttccacgagtcatgtcaacacag
cgtgttgctaacacatcaacacagacaatgggtccacgtcctgcagctgcagccgctgca
gctactcctgctgtccgcaccgttccacagtataaatatgctgcaggagttcgcaatcct
cagcaacatcttaatgcacagccacaagttacaatgcaacagcctgctgttcatgtacaa
ggtcaggaacctttgactgcttccatgttggcatctgcccctcctcaagagcaaaagcaa
atgttgggtgaacggctgtttcctcttattcaagccatgcaccctactcttgctggtaaa
atcactggcatgttgttggagattgataattcagaacttcttcatatgctcgagtctcca
gagtcactccgttctaaggttgatgaagctgtagctgtactacaagcccaccaagctaaa
gaggctgcccagaaagcagttaacagtgccaccggtgttccaactgtttaa

DBGET integrated database retrieval system