KEGG   Homo sapiens (human): 27043Help
Entry
27043             CDS       T01001                                 

Gene name
PELP1, MNAR, P160
Definition
(RefSeq) proline, glutamate and leucine rich protein 1
  KO
K16913  
proline-, glutamic acid- and leucine-rich protein 1
Organism
hsa  Homo sapiens (human)
Brite
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   5-FMC complex
    27043 (PELP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.2
AA seq 1180 aa AA seqDB search
MLLPSLSPRVQPAFTQCARPQPPPHAPSPVGGRRGVFASSRHATTGTRGKMAAAVLSGPS
AGSAAGVPGGTGGLSAVSSGPRLRLLLLESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLM
CLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVS
WLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPE
CEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGF
SQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNEGPGVEMLLSSEDGDAHVLLQ
LRQRFSGLARCLGLMLSSEFGAPVSVPVQEILDFICRTLSVSSKNISLHGDGPLRLLLLP
SIHLEALDLLSALILACGSRLLRFGILIGRLLPQVLNSWSIGRDSLSPGQERPYSTVRTK
VYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPRGSPDGSLQTGK
PSAPKKLKLDVGEAMAPPSHRKGDSNANSDVCAAALRGLSRTILMCGPLIKEETHRRLHD
LVLPLVMGVQQGEVLGSSPYTSSRCRRELYCLLLALLLAPSPRCPPPLACALQAFSLGQR
EDSLEVSSFCSEALVTCAALTHPRVPPLQPMGPTCPTPAPVPPPEAPSPFRAPPFHPPGP
MPSVGSMPSAGPMPSAGPMPSAGPVPSARPGPPTTANHLGLSVPGLVSVPPRLLPGPENH
RAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVI
VPEGLPPLPPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVP
GPVTLPPPQLVPEGTPGGGGPPALEEDLTVININSSDEEEEEEEEEEEEEEEEEEEEEDF
EEEEEDEEEYFEEEEEEEEEFEEEFEEEEGELEEEEEEEDEEEEEELEEVEDLEFGTAGG
EVEEGAPPPPTLPPALPPPESPPKVQPEPEPEPGLLLEVEEPGTEEERGADTAPTLAPEA
LPSQGEVEREGESPAAGPPPQELVEEEPSAPPTLLEEETEDGSDKVQPPPETPAEEEMET
ETEAEALQEKEQDDTAAMLADFIDCPPDDEKPPPPTEPDS
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atgctccttcccagcttgagcccgcgagtccagcctgccttcactcagtgcgcaagaccg
cagccccctccccacgccccctccccagtaggcggccgtcgcggtgtgtttgcgtcatcg
cgccacgccaccactggaacccgggggaagatggcggcagccgttctgagtgggccctct
gcgggctccgcggctggggttcctggcgggaccgggggtctctcggcagtgagctcgggc
ccgcggctccgcctgctgctgctggagagtgtttctggtttgctgcaacctcgaacgggg
tctgccgttgctccggtgcatcccccaaaccgctcggccccacatttgcccgggctcatg
tgcctattgcggctgcatgggtcggtgggcggggcccagaacctttcagctcttggggca
ttggtgagtctcagtaatgcacgtctcagttccatcaaaactcggtttgagggcctgtgt
ctgctgtccctgctggtaggggagagccccacagagctattccagcagcactgtgtgtct
tggcttcggagcattcagcaggtgttacagacccaggacccgcctgccacaatggagctg
gccgtggctgtcctgagggacctcctccgatatgcagcccagctgcctgcactgttccgg
gacatctccatgaaccacctccctggccttctcacctccctgctgggcctcaggccagag
tgtgagcagtcagcattggaaggaatgaaggcttgtatgacctatttccctcgggcttgt
ggttctctcaaaggcaagctggcctcattttttctgtctagggtggatgccttgagccct
cagctccaacagttggcctgtgagtgttattcccggctgccctctttaggggctggcttt
tcccaaggcctgaagcacaccgagagctgggagcaggagctacacagtctgctggcctca
ctgcacaccctgctgggggccctgtacgagggagcagagactgctcctgtgcagaatgaa
ggccctggggtggagatgctgctgtcctcagaagatggtgatgcccatgtccttctccag
cttcggcagaggttttcgggactggcccgctgcctagggctcatgctcagctctgagttt
ggagctcccgtgtccgtccctgtgcaggaaatcctggatttcatctgccggaccctcagc
gtcagtagcaagaatattagcttgcatggagatggtcccctgcggctgctgctgctgccc
tctatccaccttgaggccttggacctgctgtctgcactcatcctcgcgtgtggaagccgg
ctcttgcgctttgggatcctgatcggccgcctgcttccccaggtcctcaattcctggagc
atcggtagagattccctctctccaggccaggagaggccttacagcacggttcggaccaag
gtgtatgcgatattagagctgtgggtgcaggtttgtggggcctcggcgggaatgcttcag
ggaggagcctctggagaggccctgctcacccacctgctcagcgacatctccccgccagct
gatgcccttaagctgcgtagcccgcgggggagccctgatgggagtttgcagactgggaag
cctagcgcccccaagaagctaaagctggatgtgggggaagctatggccccgccaagccac
cggaaaggggatagcaatgccaacagcgacgtgtgtgcggctgcactcagaggcctcagc
cggaccatcctcatgtgtgggcctctcatcaaggaggagactcacaggagactgcatgac
ctggtcctccccctggtcatgggtgtacagcagggtgaggtcctaggcagctccccgtac
acgagctcccgctgccgccgtgaactctactgcctgctgctggcgctgctgctggccccg
tctcctcgctgcccacctcctcttgcctgtgccctgcaagccttctccctcggccagcga
gaagatagccttgaggtctcctctttctgctcagaagcactggtgacctgtgctgctctg
acccacccccgggttcctcccctgcagcccatgggccccacctgccccacacctgctcca
gttccccctcctgaggccccatcgcccttcagggccccaccgttccatcctccgggcccc
atgccctcagtgggctccatgccctcagcaggccccatgccttcagcaggccccatgccc
tcagcaggccctgtgccctcggcacgccctggacctcccaccacagccaaccacctaggc
ctttctgtcccaggcctagtgtctgtccctccccggcttcttcctggccctgagaaccac
cgggcaggctcaaatgaggaccccatccttgcccctagtgggactcccccacctactata
cccccagatgaaacttttggggggagagtgcccagaccagcctttgtccactatgacaag
gaggaggcatctgatgtggagatctccttggaaagtgactctgatgacagcgtggtgatc
gtgcccgaggggcttccccccctgccacccccaccaccctcaggtgccacaccaccccct
atagcccccactgggccaccaacagcctcccctcctgtgccagcgaaggaggagcctgaa
gaacttcctgcagccccagggcctctcccgccacccccacctccgccgccgcctgttcct
ggtcctgtgacgctccctccaccccagttggtccctgaagggactcctggtgggggagga
cccccagccctggaagaggatttgacagttattaatatcaacagcagtgatgaagaggag
gaggaagaggaagaagaggaagaagaagaagaggaagaagaggaagaggaggaagacttt
gaggaagaggaagaggatgaagaggaatattttgaagaggaagaagaggaggaagaagag
tttgaggaagaatttgaggaagaagaaggtgagttagaggaagaagaagaagaggaggat
gaggaggaggaagaagaactggaagaggtggaagacctggagtttggcacagcaggaggg
gaggtagaagaaggtgcacctccacccccaaccctgcctccagctctgcctccccctgag
tctcccccaaaggtgcagccagaacccgaacctgaacccgggctgcttttggaagtggag
gagccagggacggaggaggagcgtggggctgacacagctcccaccctggcccctgaagcg
ctcccctcccagggagaggtggagagggaaggggaaagccctgcggcagggccccctccc
caggagcttgttgaagaagagccctctgctcccccaaccctgttggaagaggagactgag
gatgggagtgacaaggtgcagcccccaccagagacacctgcagaagaagagatggagaca
gagacagaggccgaagctctccaggaaaaggagcaggatgacacagctgccatgctggcc
gacttcatcgattgtccccctgatgatgagaagccaccacctcccacagagcctgactcc
tag

DBGET integrated database retrieval system