KEGG   Homo sapiens (human): 27288Help
Entry
27288             CDS       T01001                                 

Gene name
RBMXL2, HNRNPG-T, HNRNPGT, HNRPGT
Definition
(RefSeq) RNA binding motif protein, X-linked-like 2
  KO
K12885  
heterogeneous nuclear ribonucleoprotein G
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    27288 (RBMXL2)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    27288 (RBMXL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15
AA seq 392 aa AA seqDB search
MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPA
DAKAAARDMNGKSLDGKAIKVAQATKPAFESSRRGPPPPRSRGRPRFLRGTRGGGGGPRR
SPSRGGPDDDGGYTADFDLRPSRAPMPMKRGPPPRRVGPPPKRAAPSGPARSSGGGMRGR
ALAVRGRDGYSGPPRREPLPPRRDPYLGPRDEGYSSRDGYSSRDYREPRGFAPSPGEYTH
RDYGHSSVRDDCPLRGYSDRDGYGGRDRDYGDHLSRGSHREPFESYGELRGAAPGRGTPP
SYGGGGRYEEYRGYSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGLSLSMERGCPP
QRDSYSRSGCRVPRGGGRLGGRLERGGGRSRY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagcggatcgcccggggaagctgttcattgggggcctcaacctcgaaaccgac
gagaaagccctcgaagccgagtttggcaagtatggccgcatcgtcgaggtgctcctgatg
aaagaccgagaaaccaacaagtcgaggggcttcgcgttcgtcacctttgaaagccccgca
gacgccaaggccgccgccagagacatgaacggcaagtccctggatggtaaggccatcaag
gtggcccaggccaccaaaccggcgttcgagagcagccggcggggcccgccgcctccccgc
agccgcggtcgcccgaggttcctgcgcggaacccgcgggggtggcggcggcccgcggcgt
tccccatcccggggcgggcccgatgatgacggcggctacacggcggatttcgacctgcgg
ccctccagggccccgatgcccatgaagcgtgggccgccgccgcgcagggtcggcccaccc
cccaagagggccgcgccgtcgggcccggctcgcagcagcggcggtggaatgcgcgggagg
gccctggccgtgcgggggcgagacggctactcaggcccaccgcgccgggagccgctgccc
ccgcgccgcgacccctacctgggcccgcgggatgagggctactcgtccagagacggctac
tcgagccgagactaccgcgaaccccggggttttgccccctcgcccggagagtacacccac
cgcgattacggccactccagtgtccgggacgactgtcccttgagaggctacagcgaccga
gacggctacggaggtcgcgaccgtgactacggggatcatctgagcagaggctcccatcga
gagccctttgagagctacggagagctgcgcggcgccgccccaggacgggggacaccgcca
tcttacggaggaggaggccgctacgaggagtaccggggctactcacccgatgcctacagc
ggcggccgcgacagttacagcagcagttatggccggagcgaccgctactcgaggggccga
caccgggtgggcagaccagatcgtgggctctctctgtccatggaaaggggctgccctccc
cagcgtgattcttacagccggtcaggctgcagggtgcccaggggcggaggccgtctagga
ggccgcttggagagaggaggaggccggagcagatactaa

DBGET integrated database retrieval system