KEGG   Homo sapiens (human): 27332Help
Entry
27332             CDS       T01001                                 

Gene name
ZNF638, NP220, ZFML, Zfp638
Definition
(RefSeq) zinc finger protein 638
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13.1
AA seq 1978 aa AA seqDB search
MSRPRFNPRGDFPLQRPRAPNPSGMRPPGPFMRPGSMGLPRFYPAGRARGIPHRFAGHES
YQNMGPQRMNVQVTQHRTDPRLTKEKLDFHEAQQKKGKPHGSRWDDEPHISASVAVKQSS
VTQVTEQSPKVQSRYTKESASSILASFGLSNEDLEELSRYPDEQLTPENMPLILRDIRMR
KMGRRLPNLPSQSRNKETLGSEAVSSNVIDYGHASKYGYTEDPLEVRIYDPEIPTDEVEN
EFQSQQNISASVPNPNVICNSMFPVEDVFRQMDFPGESSNNRSFFSVESGTKMSGLHISG
GQSVLEPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQERIPHEPVINSS
NVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKFSHADAQKMKRLPTPSMMNDYYAAS
PRIFPHLCSLCNVECSHLKDWIQHQNTSTHIESCRQLRQQYPDWNPEILPSRRNEGNRKE
NETPRRRSHSPSPRRSRRSSSSHRFRRSRSPMHYMYRPRSRSPRICHRFISRYRSRSRSR
SPYRIRNPFRGSPKCFRSVSPERMSRRSVRSSDRKKALEDVVQRSGHGTEFNKQKHLEAA
DKGHSPAQKPKTSSGTKPSVKPTSATKSDSNLGGHSIRCKSKNLEDDTLSECKQVSDKAV
SLQRKLRKEQSLHYGSVLLITELPEDGCTEEDVRKLFQPFGKVNDVLIVPYRKEAYLEME
FKEAITAIMKYIETTPLTIKGKSVKICVPGKKKAQNKEVKKKTLESKKVSASTLKRDADA
SKAVEIVTSTSAAKTGQAKASVAKVNKSTGKSASSVKSVVTVAVKGNKASIKTAKSGGKK
SLEAKKTGNVKNKDSNKPVTIPENSEIKTSIEVKATENCAKEAISDAALEATENEPLNKE
TEEMCVMLVSNLPNKGYSVEEVYDLAKPFGGLKDILILSSHKKAYIEINRKAAESMVKFY
TCFPVLMDGNQLSISMAPENMNIKDEEAIFITLVKENDPEANIDTIYDRFVHLDNLPEDG
LQCVLCVGLQFGKVDHHVFISNRNKAILQLDSPESAQSMYSFLKQNPQNIGDHMLTCSLS
PKIDLPEVQIEHDPELEKESPGLKNSPIDESEVQTATDSPSVKPNELEEESTPSIQTETL
VQQEEPCEEEAEKATCDSDFAVETLELETQGEEVKEEIPLVASASVSIEQFTENAEECAL
NQQMFNSDLEKKGAEIINPKTALLPSDSVFAEERNLKGILEESPSEAEDFISGITQTMVE
AVAEVEKNETVSEILPSTCIVTLVPGIPTGDEKTVDKKNISEKKGNMDEKEEKEFNTKET
RMDLQIGTEKAEKNEGRMDAEKVEKMAAMKEKPAENTLFKAYPNKGVGQANKPDETSKTS
ILAVSDVSSSKPSIKAVIVSSPKAKATVSKTENQKSFPKSVPRDQINAEKKLSAKEFGLL
KPTSARSGLAESSSKFKPTQSSLTRGGSGRISALQGKLSKLDYRDITKQSQETEARPSIM
KRDDSNNKTLAEQNTKNPKSTTGRSSKSKEEPLFPFNLDEFVTVDEVIEEVNPSQAKQNP
LKGKRKETLKNVPFSELNLKKKKGKTSTPRGVEGELSFVTLDEIGEEEDAAAHLAQALVT
VDEVIDEEELNMEEMVKNSNSLFTLDELIDQDDCISHSEPKDVTVLSVAEEQDLLKQERL
VTVDEIGEVEELPLNESADITFATLNTKGNEGDTVRDSIGFISSQVPEDPSTLVTVDEIQ
DDSSDLHLVTLDEVTEEDEDSLADFNNLKEELNFVTVDEVGEEEDGDNDLKVELAQSKND
HPTDKKGNRKKRAVDTKKTKLESLSQVGPVNENVMEEDLKTMIERHLTAKTPTKRVRIGK
TLPSEKAVVTEPAKGEEAFQMSEVDEESGLKDSEPERKRKKTEDSSSGKSVASDVPEELD
FLVPKAGFFCPICSLFYSGEKAMTNHCKSTRHKQNTEKFMAKQRKEKEQNEAEERSSR
NT seq 5937 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagacccaggtttaatcctcgaggagactttccacttcaaaggccacgagcacct
aacccttctgggatgaggcctccaggaccatttatgaggcctggatctatgggtctccca
agattttacccagcagggagagcacgtggaattccacacagatttgctggccatgaatct
tatcagaacatggggccacagagaatgaatgttcaggtaactcaacacagaactgatcca
agattgaccaaagaaaaactggattttcatgaagcacaacagaagaaggggaagcctcat
ggtagccggtgggatgatgagcctcatatatctgcatcagtggcagtgaaacagagttct
gtaacacaggttacagagcagagtcccaaagtacagagccgctatacaaaagagagtgcc
tcaagtatcttagcaagttttggattatctaatgaagacctagaagaacttagtcgctat
cctgatgaacaactaactcctgaaaatatgccattaattttgagggatataagaatgcga
aaaatggggcgccgattacctaatttaccttctcagagcagaaataaagaaacacttggt
agtgaagcagtttcaagtaatgtgatcgattatgggcatgcaagcaaatatggctacaca
gaagatccacttgaagtacgtatttatgatcctgaaattccaactgatgaggtcgagaat
gaatttcagtcacagcagaacatttctgcatctgttcccaatccaaatgtgatatgtaat
tctatgtttcctgttgaagacgtatttcgccaaatggacttccccggtgagtcctccaat
aatcggtcctttttctcagttgagagtggaaccaagatgtcaggcttacacatttcagga
ggacagtcagtccttgaacccataaaatccgtcaaccaatccattaaccaaacagttagc
cagacaatgagtcaatctctgattcctccatctatgaaccagcaacctttttcgtcggaa
ttaatttcatctgtaagccagcaagagcggatcccacatgaacctgtgattaattcatct
aacgtacatgttggatcaagaggaagtaaaaagaattaccagtcacaggctgacattccc
attcggtctccctttggtattgtgaaagcatcctggctaccaaagttttcacatgctgat
gcccagaagatgaagagacttccaactccttctatgatgaatgattattatgcagcatct
ccaagaatatttccacatttgtgttctctgtgtaacgtagaatgtagtcatttgaaggat
tggattcagcatcaaaatacatctactcatattgagagctgtcgacagttacgtcaacag
tatcctgattggaatcctgagatcctcccatcgagaagaaatgagggcaatagaaaagaa
aatgaaactccacgaagacgttctcattcccccagtcctaggcgttctagaagatcaagc
tcaagtcacagattccgtcggtctcgaagcccaatgcattacatgtataggccgagaagt
cgaagtccaagaatttgccatcgtttcatttctagatacagatccagatccagatcccgt
tcaccatatcgaattagaaatccatttagaggtagtccaaaatgctttcgatcagttagc
cctgagaggatgtcaaggagatcagtgagatcatcagatagaaaaaaagcattagaagat
gtagtacaacgatctgggcatgggacagaatttaataaacagaagcatcttgaagctgct
gataagggacattcaccagcacaaaagcctaaaactagcagtggaacaaaaccatcagtt
aaacctacaagcgctacaaagagtgattcaaatctaggaggacattctattcgttgtaaa
tcaaagaatcttgaagatgacactttgtcagaatgtaaacaggtgtctgataaagctgtt
tctctccagcgaaagcttcggaaagaacagtcattgcattatggttcggttcttcttata
actgaattaccagaggatggttgtactgaagaagatgtgagaaaattatttcaaccattt
gggaaagtgaatgatgtcctaattgttccatatagaaaagaggcttacctagaaatggaa
tttaaagaggcaattactgcaattatgaagtacattgaaacaacacctcttacgataaaa
ggaaaaagtgtgaaaatatgtgttccaggaaagaaaaaagcacagaacaaagaggtgaag
aaaaagactttagagtcaaagaaagtatctgcatctaccttaaaaagagatgcagatgct
tcaaaagctgttgaaattgttacttcaacttctgctgccaaaactggacaagccaaggca
tctgtagccaaagtaaacaaatctacagggaaatcagcaagttctgtaaaatctgtggta
acggtagctgttaaaggtaataaagcttcaatcaaaacagcaaaatctggtggaaagaag
tctctagaagccaaaaagactgggaatgtcaaaaacaaagactctaacaaacctgtgact
ataccagaaaactctgaaataaagaccagtattgaagtcaaagccactgaaaactgtgct
aaagaagctatttctgatgctgctttggaggccacagagaatgaaccacttaacaaggaa
acagaagaaatgtgtgtgatgcttgtctctaatttgcctaataaaggatattctgtagaa
gaagtttatgacttagcaaaaccatttggtggtttaaaggatatcttgattttatcatct
cataaaaaggcatatatagaaataaatagaaaagctgctgagtctatggtaaaattttat
acctgcttcccagtattgatggatggaaatcaactctcaataagtatggctcctgaaaac
atgaatataaaagatgaggaagctatatttataaccttggtaaaagaaaatgacccagag
gcaaacatagatacaatttatgatcgatttgtacatcttgataatttaccggaagatgga
cttcagtgtgtactttgtgttggacttcagtttggaaaagtggatcaccatgtattcata
agtaatagaaacaaggcaattcttcagttagatagtcctgaatctgctcagtcaatgtat
agctttctgaaacaaaatccacaaaatattggtgaccatatgttgacctgctcattatct
ccaaagatagacttaccagaggtgcaaattgagcatgacccagaattagaaaaagaaagc
cctggcttgaaaaacagtccaattgatgaaagtgaggtgcaaacagcaactgatagtccc
tctgttaaacctaatgagcttgaagaagaaagtactcccagcattcaaacagaaactttg
gtacagcaggaagagccttgtgaggaagaagctgaaaaagcaacatgtgattctgacttt
gctgttgaaactttggagcttgaaactcaaggagaggaggtcaaagaagaaattcctctt
gtagcatccgcttcagtcagtattgaacaattcactgaaaatgccgaggagtgtgcttta
aatcagcagatgtttaacagtgacttggagaagaaaggggcagaaattattaaccctaaa
acagcattgttaccatctgacagtgtgtttgcagaagaaaggaacctcaaaggaattcta
gaagaatctccatctgaagcagaagatttcatttctggaattacacagactatggtagaa
gctgtagctgaagtagaaaaaaatgaaactgtttcggaaatattgccatcaacttgtatt
gtgacgttagtaccaggaattcccactggggatgagaagacagtggacaaaaagaatatt
tctgaaaaaaaaggtaacatggatgaaaaggaggagaaggaatttaatactaaggaaacc
agaatggatcttcaaataggaacagagaaggctgaaaagaatgaaggtaggatggatgca
gaaaaggtggaaaagatggcagcaatgaaagaaaagcctgcagaaaacactttattcaag
gcatacccaaataaaggagtgggtcaggctaataagcctgatgaaactagtaaaactagt
attctggctgtatcagatgtatctagcagtaaaccaagcatcaaggctgttatagtctct
tctcctaaggcaaaagctacagtttcaaaaactgaaaatcagaaaagttttccaaaatct
gtgcccagagatcaaataaatgctgaaaagaaactttcagccaaggaatttggtctgctt
aaacccacaagtgccaggtcaggcttggcagaaagcagcagtaaattcaaacctactcag
agcagtcttaccagaggaggcagtggaaggatctcagccctgcaaggcaagctttctaaa
ctggattacagagatataacaaaacaatctcaggaaacagaggctagaccttccatcatg
aaacgggatgacagcaacaataagactttggctgagcaaaacactaagaatcctaaaagc
actactggtagaagttccaaatctaaagaggagccattatttccatttaatttggatgaa
tttgttactgtggatgaggttatagaagaagtgaatccttctcaggccaagcagaatcca
ctaaagggaaaaaggaaagaaactctcaaaaatgttcctttctctgaacttaacttaaag
aagaaaaaggggaaaacttccactcctcgtggtgttgagggagaactatcttttgtgaca
ttggatgagattggggaagaggaagatgcagctgcacatctagcacaagctctagtcact
gtggatgaagtaattgatgaagaagaactaaatatggaagaaatggtaaaaaattcaaat
tcactttttacattagatgaattaattgaccaagatgattgcatttcccacagtgaacct
aaagatgttactgttctgtcagtggctgaagaacaagatctcctcaaacaggaacgcttg
gtaactgtggatgaaattggagaagtggaagagctacctttgaatgagtcagcagacata
acttttgccactttaaatactaaaggaaatgaaggagatactgtaagggattccattggc
ttcatttcttctcaggtgcccgaagacccttctactttagttactgtagatgaaatacaa
gatgacagcagtgatttgcatttagtgactttggatgaagtaactgaagaggatgaagac
tctctggcggattttaacaaccttaaagaagagcttaattttgttactgttgatgaagtt
ggagaggaggaagatggagataatgatttaaaagttgagttagcacaaagcaaaaatgac
catcccacagataaaaaagggaatagaaagaagagagctgtggacacaaaaaagacaaaa
cttgaatccttgtcccaagtgggtccagtaaatgagaatgttatggaagaagatctaaaa
accatgattgaaagacacttaacagctaaaactccaaccaagagagttagaattgggaaa
actctgccatcagaaaaagctgttgtgacagaaccagcaaaaggtgaagaggccttccag
atgagtgaagttgatgaggaatctggattaaaggattcagaaccagagcgaaaacgcaag
aagactgaagactcttcttcaggcaaatcagtggcgtctgatgtccctgaggaattagac
tttcttgtacctaaggctggattcttctgtccaatttgttccctcttctactcaggtgaa
aaagcaatgacaaatcactgcaagagtacacgtcataagcaaaatactgagaaattcatg
gccaagcaaagaaaggaaaaggagcagaatgaggctgaagaaagaagctctaggtga

DBGET integrated database retrieval system