KEGG   Homo sapiens (human): 2780Help
Entry
2780              CDS       T01001                                 

Gene name
GNAT2, ACHM4, GNATC
Definition
guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2
Orthology
K04631  
guanine nucleotide-binding protein G(t) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Phototransduction
Disease
H00971  
Achromatopsia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04744 Phototransduction
    2780 (GNAT2)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2780 (GNAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p13.1
AA seq 354 aa AA seqDB search
MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDG
YSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMP
PELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVK
TTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEV
NRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAG
NYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtggagccagtgctgaggacaaagaactggccaagaggtccaaggagctagaa
aagaagctgcaggaggatgctgataaggaagccaagactgtcaagctgctactgctgggt
gctggggagtcaggaaagagcaccatcgtcaaacagatgaagatcattcaccaggatggc
tattcaccagaagaatgcctggagttcaaggctatcatctatggaaatgtgctgcagtcc
atcctggctatcatccgggccatgaccacactgggcatcgattatgctgaaccaagctgt
gcggatgacgggcgacagctcaacaacctggctgactccattgaggagggaaccatgcct
cctgagctcgtggaggtcattaggaggttgtggaaggatggtggggtgcaagcctgcttc
gagagagctgcagaataccagcttaatgactccgcatcttactacctgaaccaattagaa
cgaattacagaccctgagtacctccctagtgagcaagatgtgctccgatccagagtcaaa
accacgggcatcattgaaaccaagttttccgtcaaagacttgaatttcaggatgtttgat
gtgggagggcagagatccgagagaaagaagtggatccactgcttcgagggagtcacctgc
atcattttctgtgcagccctcagtgcctatgatatggtgctggtggaagatgacgaagtg
aatcgtatgcatgagtctttgcatctgttcaacagcatatgtaaccacaaattctttgcg
gctacttccattgtcctctttctcaacaagaaggacctctttgaggaaaaaatcaagaaa
gtccatctcagcatttgttttccagagtatgatggtaacaactcctatgatgatgcgggg
aattacataaagagccagttccttgacctcaatatgcgaaaagatgtcaaagaaatctac
agtcacatgacctgtgctacagatacacagaatgtcaaatttgtgtttgatgcagttaca
gatattatcatcaaagaaaacctcaaggactgcggcctcttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system