KEGG   Homo sapiens (human): 2780Help
Entry
2780              CDS       T01001                                 

Gene name
GNAT2, ACHM4, GNATC
Definition
(RefSeq) G protein subunit alpha transducin 2
  KO
K04631  guanine nucleotide-binding protein G(t) subunit alpha 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04744  Phototransduction
Disease
H00971  Achromatopsia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04744 Phototransduction
    2780 (GNAT2)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2780 (GNAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA DAP3 AAA_29
Motif
Other DBs
NCBI-GeneID: 2780
NCBI-ProteinID: NP_005263
OMIM: 139340
HGNC: 4394
Ensembl: ENSG00000134183
Vega: OTTHUMG00000011639
Pharos: P19087(Tbio)
UniProt: P19087 Q5T697
Position
1p13.3
AA seq 354 aa AA seqDB search
MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDG
YSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMP
PELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVK
TTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEV
NRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAG
NYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtggagccagtgctgaggacaaagaactggccaagaggtccaaggagctagaa
aagaagctgcaggaggatgctgataaggaagccaagactgtcaagctgctactgctgggt
gctggggagtcaggaaagagcaccatcgtcaaacagatgaagatcattcaccaggatggc
tattcaccagaagaatgcctggagttcaaggctatcatctatggaaatgtgctgcagtcc
atcctggctatcatccgggccatgaccacactgggcatcgattatgctgaaccaagctgt
gcggatgacgggcgacagctcaacaacctggctgactccattgaggagggaaccatgcct
cctgagctcgtggaggtcattaggaggttgtggaaggatggtggggtgcaagcctgcttc
gagagagctgcagaataccagcttaatgactccgcatcttactacctgaaccaattagaa
cgaattacagaccctgagtacctccctagtgagcaagatgtgctccgatccagagtcaaa
accacgggcatcattgaaaccaagttttccgtcaaagacttgaatttcaggatgtttgat
gtgggagggcagagatccgagagaaagaagtggatccactgcttcgagggagtcacctgc
atcattttctgtgcagccctcagtgcctatgatatggtgctggtggaagatgacgaagtg
aatcgtatgcatgagtctttgcatctgttcaacagcatatgtaaccacaaattctttgcg
gctacttccattgtcctctttctcaacaagaaggacctctttgaggaaaaaatcaagaaa
gtccatctcagcatttgttttccagagtatgatggtaacaactcctatgatgatgcgggg
aattacataaagagccagttccttgacctcaatatgcgaaaagatgtcaaagaaatctac
agtcacatgacctgtgctacagatacacagaatgtcaaatttgtgtttgatgcagttaca
gatattatcatcaaagaaaacctcaaggactgcggcctcttctaa

DBGET integrated database retrieval system