KEGG   Homo sapiens (human): 28234Help
Entry
28234             CDS       T01001                                 

Gene name
SLCO1B3, HBLRR, LST-2, LST-3TM13, LST3, OATP-8, OATP1B3, OATP8, SLC21A8
Definition
(RefSeq) solute carrier organic anion transporter family member 1B3
  KO
K05043  solute carrier organic anion transporter family, member 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
Disease
H00208  Hyperbilirubinemia
H02057  Rotor syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    28234 (SLCO1B3)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC21/ASLCO: Organic anion transporter
   28234 (SLCO1B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1
Motif
Other DBs
NCBI-GeneID: 28234
NCBI-ProteinID: NP_062818
OMIM: 605495
HGNC: 10961
Ensembl: ENSG00000111700
Vega: OTTHUMG00000169011
Pharos: Q9NPD5(Tchem)
UniProt: Q9NPD5 B3KP78
Position
12p12.2
AA seq 702 aa AA seqDB search
MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFD
ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGY
YRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNML
RGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFALGSLFAKMYVDIGYV
DLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLK
TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVF
KYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL
FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGIT
YLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAI
QVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCM
KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASD
NERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAAN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacatcaacatttgaataaaacagcagagtcagcatcttcagagaaaaagaaa
acaagacgctgcaatggattcaagatgttcttggcagccctgtcattcagctatattgct
aaagcactaggtggaatcattatgaaaatttccatcactcaaatagaaaggagatttgac
atatcctcttctcttgctggtttaattgatggaagctttgaaattggaaatttgcttgtg
attgtatttgtaagttactttggatctaaactacacagaccgaagttaattggaattggt
tgtctccttatgggaactggaagtattttgacatctttaccacatttcttcatgggatat
tataggtattctaaagaaacccatattaatccatcagaaaattcaacatcaagtttatca
acctgtttaattaatcaaaccttatcattcaatggaacatcacctgagatagtagaaaaa
gattgtgtaaaggaatctgggtcacacatgtggatctatgtcttcatggggaatatgctt
cgtggcataggggaaacccccatagtaccattggggatttcatacattgatgattttgca
aaagaaggacattcttccttgtatttaggtagtttgaatgcaataggaatgattggtcca
gtcattggctttgcactgggatctctgtttgctaaaatgtacgtggatattggatatgta
gatctgagcactatcagaataactcctaaggactctcgttgggttggagcttggtggctt
ggtttccttgtgtctggactattttccattatttcttccataccattttttttcttgccg
aaaaatccaaataaaccacaaaaagaaagaaaaatttcactatcattgcatgtgctgaaa
acaaatgatgatagaaatcaaacagctaatttgaccaaccaaggaaaaaatgttaccaaa
aatgtgactggttttttccagtctttgaaaagcatccttaccaatcccctgtatgttata
tttctgcttttgacattgttacaagtaagcagctttattggttcttttacttacgtcttt
aaatatatggagcaacagtacggtcagtctgcatctcatgctaactttttgttgggaatc
ataaccattcctacggttgcaactggaatgtttttaggaggatttatcattaaaaaattc
aaattgtctttagttggaattgccaaattttcatttcttacttcgatgatatccttcttg
tttcaacttctatatttccctctaatctgcgaaagcaaatcagttgccggcctaaccttg
acctatgatggaaataattcagtggcatctcatgtagatgtaccactttcttattgcaac
tcagagtgcaattgtgatgaaagtcagtgggaaccagtctgtgggaacaatggaataact
tacctgtcaccttgtctagcaggatgcaaatcctcaagtggtattaaaaagcatacagtg
ttttataactgtagttgtgtggaagtaactggtctccagaacagaaattactcagcacac
ttgggtgaatgcccaagagataatacttgtacaaggaaatttttcatctatgttgcaatt
caagtcataaactctttgttctctgcaacaggaggtaccacatttatcttgttgactgtg
aagattgttcaacctgaattgaaagcacttgcaatgggtttccagtcaatggttataaga
acactaggaggaattctagctccaatatattttggggctctgattgataaaacatgtatg
aagtggtccaccaacagctgtggagcacaaggagcttgtaggatatataattccgtattt
tttggaagggtctacttgggcttatctatagctttaagattcccagcacttgttttatat
attgttttcatttttgctatgaagaaaaaatttcaaggaaaagataccaaggcatcggac
aatgaaagaaaagtaatggatgaagcaaacttagaattcttaaataatggtgaacatttt
gtaccttctgctggaacagatagtaaaacatgtaatttggacatgcaagacaatgctgct
gccaactaa

DBGET integrated database retrieval system