KEGG   Homo sapiens (human): 2969Help
Entry
2969              CDS       T01001                                 

Gene name
GTF2I, BAP135, BTKAP1, DIWS, GTFII-I, IB291, SPIN, TFII-I, WBS, WBSCR6
Definition
(RefSeq) general transcription factor IIi
  KO
K03121  
transcription initiation factor TFII-I
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
cGMP-PKG signaling pathway
Herpes simplex infection
Disease
H01439  
Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2969 (GTF2I)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    2969 (GTF2I)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    2969 (GTF2I)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     2969 (GTF2I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.23
AA seq 998 aa AA seqDB search
MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVYETDVFVVGTE
RGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYF
CFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGI
SFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVK
EESEDPDYYQYNIQAGPSETDDVDEKQPLSKPLQGSHHSSEGNEGTEMEVPAEDSTQHVP
SETSEDPEVEVTIEDDDYSPPSKRPKANELPQPPVPEPANAGKRKVREFNFEKWNARITD
LRKQVEELFERKYAQAIKAKGPVTIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLE
RILLAKERIRFVIKKHELLNSTREDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAE
ALGSTEAKAVPYQKFEAHPNDLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKR
PELLTHSTTEVTQPRTNTPVKEDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVF
ESNPEFLYVEGLPEGIPFRSPTWFGIPRLERIVRGSNKIKFVVKKPELVISYLPPGMASK
INTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNNPQTSAVRTPTQTNGSNVPFKPRGRE
FSFEAWNAKITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPF
RRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESTSSKSPPRKINSSPNVNTTASG
VEDLNIIQVTIPDDDNERLSKVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITIN
PGCVVVDGMPPGVSFKAPSYLEISSMRRILDSAEFIKFTVIRPFPGLVINNQLVDQSESE
GPVIQESAEPSQLEVPATEEIKETDGSSQIKQEPDPTW
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagttgcaatgtccaccctccccgttgaagatgaggagtcctcggagagcagg
atggtggtgacattcctcatgtcagctctcgagtccatgtgtaaagaactggccaagtcc
aaagccgaagtggcctgcattgcagtgtatgaaacagacgtgtttgtcgtcggaactgaa
agaggacgtgcttttgtcaataccagaaaggattttcaaaaagattttgtaaaatattgt
gttgaagaagaagaaaaagctgcagagatgcataaaatgaaatctacaacccaggcaaat
cggatgagtgtagatgctgtagaaattgaaacactcagaaaaacagttgaggactatttc
tgcttttgctatgggaaagctttaggcaaatccacagtggtacctgtaccatatgagaag
atgctgcgagaccagtcggctgtggtagtgcaggggcttccggaaggtgttgcctttaaa
caccccgagaactatgatcttgcaaccctgaaatggattttggagaacaaagcagggatt
tcattcatcattaagagaccttttttagagccaaagaagcatgtaggtggtcgtgtgatg
gtaacagatgctgacaggtcaatactatctccaggtggaagttgtggccccatcaaagtg
aaaactgaacccacagaagattctggcatttccctggaaatggcagctgtgacagtaaag
gaagaatcagaagatcctgattattatcaatataacattcaagcaggcccttctgaaact
gatgatgttgatgaaaaacagcccctatcgaagcctttgcaaggaagccaccattcttca
gagggcaatgaaggcacagaaatggaagtaccagcagaagattctactcaacatgtccct
tcagaaacaagtgaggaccctgaagttgaggtgactattgaagatgatgattattctcca
ccgtctaagagaccaaaggccaatgagctaccgcagccaccagtcccggaacccgccaat
gctgggaagcggaaagtgagggagttcaacttcgagaaatggaatgctcgcatcactgat
ctacgtaaacaagttgaagaattgtttgaaaggaaatatgctcaagccataaaagccaaa
ggtccggtgacgatcccgtaccctcttttccagtctcatgttgaagatctttatgtagaa
ggacttcctgaaggaattccttttagaaggccatctacttacggaattcctcgcctggag
aggatattacttgcaaaggaaaggattcgttttgtgattaagaaacatgagcttctgaat
tcaacacgtgaagatttacagcttgataagccagcttcaggagtaaaggaagaatggtat
gccagaatcactaaattaagaaagatggtggatcagcttttctgcaaaaaatttgcggaa
gccttggggagcactgaagccaaggctgtaccgtaccaaaaatttgaggcacacccgaat
gatctgtacgtggaaggactgccagaaaacattcctttccgaagtccctcatggtatgga
atcccaaggctggaaaaaatcattcaagtgggcaatcgaattaaatttgttattaaaaga
ccagaacttctgactcacagtaccactgaagttactcagccaagaacgaatacaccagtc
aaagaagattggaatgtcagaattaccaagctacggaagcaagtggaagagatttttaat
ttgaaatttgctcaagctcttggactcaccgaggcagtaaaagtaccatatcctgtgttt
gaatcaaacccggagttcttgtatgtggaaggcttgccagaggggattcccttccgaagc
cctacctggtttggaattccacgacttgaaaggatcgtccgcgggagtaataaaatcaag
ttcgttgttaaaaaacctgaactagttatttcctacttgcctcctgggatggctagtaaa
ataaacactaaagctttgcagtcccccaaaagaccacgaagtcctgggagtaattcaaag
gttcctgaaattgaggtcaccgtggaaggccctaataacaacaatcctcaaacctcagct
gttcgaaccccgacccagactaacggttctaacgttcccttcaagccacgagggagagag
ttttcctttgaggcctggaatgccaaaatcacggacctaaaacagaaagttgaaaatctc
ttcaatgagaaatgtggggaagctcttggccttaaacaagctgtgaaggtgccgttcgcg
ttatttgagtctttcccggaagacttttatgtggaaggcttacctgagggtgtgccattc
cgaagaccatcgacttttggcattccgaggctggagaagatactcagaaacaaagccaaa
attaagttcatcattaaaaagcccgaaatgtttgagacggcgattaaggagagcacctcc
tctaagagccctcccagaaaaataaattcatcacccaatgttaatactactgcatcaggt
gttgaagaccttaacatcattcaggtgacaattccagatgatgataatgaaagactctcg
aaagttgaaaaagctagacagctaagagaacaagtgaatgacctctttagtcggaaattt
ggtgaagctattggtatgggttttcctgtgaaagttccctacaggaaaatcacaattaac
cctggctgtgtggtagttgatggcatgcccccgggggtgtccttcaaagcccccagctac
ctggaaatcagctccatgagaaggatcttagactctgccgagtttatcaaattcacggtc
attagaccatttccaggacttgtgattaataaccagctggttgatcagagtgagtcagaa
ggccccgtgatacaagaatcagctgaaccaagccagttggaagttccagccacagaagaa
ataaaagagactgatggaagctctcagatcaagcaagaaccagaccccacgtggtag

DBGET integrated database retrieval system