KEGG   Homo sapiens (human): 2969Help
Entry
2969              CDS       T01001                                 

Gene name
GTF2I, BAP135, BTKAP1, DIWS, GTFII-I, IB291, SPIN, TFII-I, WBS, WBSCR6
Definition
general transcription factor IIi
Orthology
K03121  
transcription initiation factor TFII-I
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Herpes simplex infection
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:hsa03022]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.23
AA seq 976 aa AA seqDB search
MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVYETDVFVVGTE
RGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYF
CFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGI
SFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVK
EESEDPDYYQYNIQGPSETDDVDEKQPLSKPLQGSHHSSEGNEGTEMEVPAEDDDYSPPS
KRPKANELPQPPVPEPANAGKRKVREFNFEKWNARITDLRKQVEELFERKYAQAIKAKGP
VTIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLERILLAKERIRFVIKKHELLNST
REDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAEALGSTEAKAVPYQKFEAHPNDL
YVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKRPELLTHSTTEVTQPRTNTPVKE
DWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVFESNPEFLYVEGLPEGIPFRSPT
WFGIPRLERIVRGSNKIKFVVKKPELVISYLPPGMASKINTKALQSPKRPRSPGSNSKVP
EIEVTVEGPNNNNPQTSAVRTPTQTNGSNVPFKPRGREFSFEAWNAKITDLKQKVENLFN
EKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAKIK
FIIKKPEMFETAIKESTSSKSPPRKINSSPNVNTTASGVEDLNIIQVTIPDDDNERLSKV
EKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITINPGCVVVDGMPPGVSFKAPSYLE
ISSMRRILDSAEFIKFTVIRPFPGLVINNQLVDQSESEGPVIQESAEPSQLEVPATEEIK
ETDGSSQIKQEPDPTW
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagttgcaatgtccaccctccccgttgaagatgaggagtcctcggagagcagg
atggtggtgacattcctcatgtcagctctcgagtccatgtgtaaagaactggccaagtcc
aaagccgaagtggcctgcattgcagtgtatgaaacagacgtgtttgtcgtcggaactgaa
agaggacgtgcttttgtcaataccagaaaggattttcaaaaagattttgtaaaatattgt
gttgaagaagaagaaaaagctgcagagatgcataaaatgaaatctacaacccaggcaaat
cggatgagtgtagatgctgtagaaattgaaacactcagaaaaacagttgaggactatttc
tgcttttgctatgggaaagctttaggcaaatccacagtggtacctgtaccatatgagaag
atgctgcgagaccagtcggctgtggtagtgcaggggcttccggaaggtgttgcctttaaa
caccccgagaactatgatcttgcaaccctgaaatggattttggagaacaaagcagggatt
tcattcatcattaagagaccttttttagagccaaagaagcatgtaggtggtcgtgtgatg
gtaacagatgctgacaggtcaatactatctccaggtggaagttgtggccccatcaaagtg
aaaactgaacccacagaagattctggcatttccctggaaatggcagctgtgacagtaaag
gaagaatcagaagatcctgattattatcaatataacattcaaggcccttctgaaactgat
gatgttgatgaaaaacagcccctatcgaagcctttgcaaggaagccaccattcttcagag
ggcaatgaaggcacagaaatggaagtaccagcagaagatgatgattattctccaccgtct
aagagaccaaaggccaatgagctaccgcagccaccagtcccggaacccgccaatgctggg
aagcggaaagtgagggagttcaacttcgagaaatggaatgctcgcatcactgatctacgt
aaacaagttgaagaattgtttgaaaggaaatatgctcaagccataaaagccaaaggtccg
gtgacgatcccgtaccctcttttccagtctcatgttgaagatctttatgtagaaggactt
cctgaaggaattccttttagaaggccatctacttacggaattcctcgcctggagaggata
ttacttgcaaaggaaaggattcgttttgtgattaagaaacatgagcttctgaattcaaca
cgtgaagatttacagcttgataagccagcttcaggagtaaaggaagaatggtatgccaga
atcactaaattaagaaagatggtggatcagcttttctgcaaaaaatttgcggaagccttg
gggagcactgaagccaaggctgtaccgtaccaaaaatttgaggcacacccgaatgatctg
tacgtggaaggactgccagaaaacattcctttccgaagtccctcatggtatggaatccca
aggctggaaaaaatcattcaagtgggcaatcgaattaaatttgttattaaaagaccagaa
cttctgactcacagtaccactgaagttactcagccaagaacgaatacaccagtcaaagaa
gattggaatgtcagaattaccaagctacggaagcaagtggaagagatttttaatttgaaa
tttgctcaagctcttggactcaccgaggcagtaaaagtaccatatcctgtgtttgaatca
aacccggagttcttgtatgtggaaggcttgccagaggggattcccttccgaagccctacc
tggtttggaattccacgacttgaaaggatcgtccgcgggagtaataaaatcaagttcgtt
gttaaaaaacctgaactagttatttcctacttgcctcctgggatggctagtaaaataaac
actaaagctttgcagtcccccaaaagaccacgaagtcctgggagtaattcaaaggttcct
gaaattgaggtcaccgtggaaggccctaataacaacaatcctcaaacctcagctgttcga
accccgacccagactaacggttctaacgttcccttcaagccacgagggagagagttttcc
tttgaggcctggaatgccaaaatcacggacctaaaacagaaagttgaaaatctcttcaat
gagaaatgtggggaagctcttggccttaaacaagctgtgaaggtgccgttcgcgttattt
gagtctttcccggaagacttttatgtggaaggcttacctgagggtgtgccattccgaaga
ccatcgacttttggcattccgaggctggagaagatactcagaaacaaagccaaaattaag
ttcatcattaaaaagcccgaaatgtttgagacggcgattaaggagagcacctcctctaag
agccctcccagaaaaataaattcatcacccaatgttaatactactgcatcaggtgttgaa
gaccttaacatcattcaggtgacaattccagatgatgataatgaaagactctcgaaagtt
gaaaaagctagacagctaagagaacaagtgaatgacctctttagtcggaaatttggtgaa
gctattggtatgggttttcctgtgaaagttccctacaggaaaatcacaattaaccctggc
tgtgtggtagttgatggcatgcccccgggggtgtccttcaaagcccccagctacctggaa
atcagctccatgagaaggatcttagactctgccgagtttatcaaattcacggtcattaga
ccatttccaggacttgtgattaataaccagctggttgatcagagtgagtcagaaggcccc
gtgatacaagaatcagctgaaccaagccagttggaagttccagccacagaagaaataaaa
gagactgatggaagctctcagatcaagcaagaaccagaccccacgtggtag

DBGET integrated database retrieval system