KEGG   Homo sapiens (human): 3052Help
Entry
3052              CDS       T01001                                 

Gene name
HCCS, CCHL, MCOPS7, MLS
Definition
holocytochrome c synthase (EC:4.4.1.17)
Orthology
K01764  
cytochrome c heme-lyase [EC:4.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
Disease
H01027  
Anophthalmia and microphthalmia (A/M)
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hsa00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.3
AA seq 268 aa AA seqDB search
MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERA
YEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVY
PSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGP
SLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQF
TILDVRPALDSLSAVWDRMKVAWWRWTS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgtctccatctgctcctgctgttgcagttcaggcctcaaatgcttcagcgtcc
ccaccttcaggatgcccgatgcatgaagggaaaatgaaaggctgtccagtgaatacagag
ccatctggcccaacctgtgagaagaaaacatactctgtgcctgcccaccaggaacgcgcc
tatgagtacgtggagtgtcccattaggggcactgcggctgagaataaggagaacctagat
ccttcaaatctgatgccaccaccaaatcaaacaccagctccagatcagccatttgcattg
tctactgtcagagaagagtcatccattccgagagcagattcagagaaaaagtgggtttac
ccttctgagcagatgttctggaatgcaatgttaaagaaagggtggaagtggaaggatgag
gatatcagtcagaaggatatgtataatatcattagaattcacaatcagaataacgagcag
gcttggaaggagattttgaagtgggaagcccttcatgctgcagagtgtccttgtggtcca
tcattgatccggtttggagggaaagcaaaagagtattcaccaagggcacgaattcgttcc
tggatggggtatgagttgccttttgataggcacgattggatcataaaccgttgcgggaca
gaagttagatatgtgattgattattatgatggtggtgaagtcaacaaggactaccagttc
accatcctggacgtccgtcctgccttagattcactttcggcagtatgggacagaatgaaa
gtcgcttggtggcgttggacctcgtaa

DBGET integrated database retrieval system