KEGG   Homo sapiens (human): 3241Help
Entry
3241              CDS       T01001                                 

Gene name
HPCAL1, BDR1, HLP2, VILIP-3
Definition
(RefSeq) hippocalcin like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 3241
NCBI-ProteinID: NP_001245286
OMIM: 600207
HGNC: 5145
Ensembl: ENSG00000115756
Vega: OTTHUMG00000090451
Pharos: P37235(Tbio)
UniProt: P37235 Q6FGY1 O75544
Structure
PDB: 

Jmol
Position
2p25.1
AA seq 193 aa AA seqDB search
MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSASQF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaacagaacagcaagctgcggcccgaggtgctgcaggacctgcgggagaacacg
gagttcaccgaccacgagctgcaggagtggtacaagggcttcctcaaggactgccccacc
ggccacctgaccgtggacgagttcaagaagatctacgccaacttcttcccctacggcgac
gcttccaagttcgccgagcacgtcttccgcaccttcgacaccaacggcgacggcaccatc
gacttccgggagttcatcattgcgctgagcgtgacctcgcggggcaagctggagcagaag
ctcaagtgggccttcagcatgtacgacctggacggcaacggctacatcagccgcagcgag
atgctggagatcgtgcaggccatctacaagatggtgtcgtctgtgatgaagatgccggag
gatgagtccaccccggagaagcgcacagacaagatcttcaggcagatggacaccaacaat
gacggcaaactgtccttggaagaattcatcagaggtgccaagagcgacccctccatcgtc
cgcctgctgcagtgcgaccccagcagtgccagtcagttctga

DBGET integrated database retrieval system