KEGG   Homo sapiens (human): 3241Help
Entry
3241              CDS       T01001                                 

Gene name
HPCAL1, BDR1, HLP2, VILIP-3
Definition
(RefSeq) hippocalcin like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p25.1
AA seq 193 aa AA seqDB search
MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSASQF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaacagaacagcaagctgcggcccgaggtgctgcaggacctgcgggagaacacg
gagttcaccgaccacgagctgcaggagtggtacaagggcttcctcaaggactgccccacc
ggccacctgaccgtggacgagttcaagaagatctacgccaacttcttcccctacggcgac
gcttccaagttcgccgagcacgtcttccgcaccttcgacaccaacggcgacggcaccatc
gacttccgggagttcatcattgcgctgagcgtgacctcgcggggcaagctggagcagaag
ctcaagtgggccttcagcatgtacgacctggacggcaacggctacatcagccgcagcgag
atgctggagatcgtgcaggccatctacaagatggtgtcgtctgtgatgaagatgccggag
gatgagtccaccccggagaagcgcacagacaagatcttcaggcagatggacaccaacaat
gacggcaaactgtccttggaagaattcatcagaggtgccaagagcgacccctccatcgtc
cgcctgctgcagtgcgaccccagcagtgccagtcagttctga

DBGET integrated database retrieval system