KEGG   Homo sapiens (human): 3275Help
Entry
3275              CDS       T01001                                 

Gene name
PRMT2, HRMT1L1
Definition
(RefSeq) protein arginine methyltransferase 2
  KO
K11435  
type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     3275 (PRMT2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     3275 (PRMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.3
AA seq 433 aa AA seqDB search
MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL
RQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
RTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLV
LQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVI
WPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL
SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLS
TGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPT
SQKVGEKVFPIWR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcaacatcaggtgactgtcccagaagtgaatcgcagggagaagagcctgctgagtgc
agtgaggccggtctcctgcaggagggagtacagccagaggagtttgtggccatcgcggac
tacgctgccaccgatgagacccagctcagttttttgagaggagaaaaaattcttatcctg
agacaaaccactgcagattggtggtggggtgagcgtgcgggctgctgtgggtacattccg
gcaaaccatgtggggaagcacgtggatgagtacgaccccgaggacacgtggcaggatgaa
gagtacttcggcagctatggaactctgaaactccacttggagatgttggcagaccagcca
cgaacaactaaataccacagtgtcatcctgcagaataaagaatccctgacggataaagtc
atcctggacgtgggctgtgggactgggatcatcagtctcttctgtgcacactatgcgcgg
cctagagcggtgtacgcggtggaggccagtgagatggcacagcacacggggcagctggtc
ctgcagaacggctttgctgacatcatcaccgtgtaccagcagaaggtggaggatgtggtg
ctgcccgagaaggtggacgtgctggtgtctgagtggatggggacctgcctgctgtttgag
ttcatgatcgagtccatcctgtatgcccgggatgcctggctgaaggaggacggggtcatt
tggcccaccatggctgcgttgcaccttgtgccctgcagtgctgataaggattatcgtagc
aaggtgctcttctgggacaacgcgtacgagttcaacctcagcgctctgaaatctttagca
gttaaggagtttttttcaaagcccaagtataaccacattttgaaaccagaagactgtctc
tctgaaccgtgcactatattgcagttggacatgagaaccgtgcaaatttctgatctagag
accctgaggggcgagctgcgcttcgacatcaggaaggcggggaccctgcacggcttcacg
gcctggtttagcgtccacttccagagcctgcaggaggggcagccgccgcaggtgctcagc
accgggcccttccaccccaccacacactggaagcagacgctgttcatgatggacgaccca
gtccctgtccatacaggagacgtggtcacgggttcagttgtgttgcagagaaacccagtg
tggagaaggcacatgtctgtggctctgagctgggctgtcacttccagacaagaccccaca
tctcaaaaagttggagaaaaagtcttccccatctggagatga

DBGET integrated database retrieval system