KEGG   Homo sapiens (human): 3315Help
Entry
3315              CDS       T01001                                 

Gene name
HSPB1, CMT2F, HEL-S-102, HMN2B, HS.76067, HSP27, HSP28, Hsp25, SRP27
Definition
heat shock 27kDa protein 1
Orthology
K04455  
heat shock protein beta-1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
VEGF signaling pathway
Amoebiasis
Epstein-Barr virus infection
Disease
H00856  
Distal hereditary motor neuropathies (dHMN)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3315 (HSPB1)
   04370 VEGF signaling pathway
    3315 (HSPB1)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    3315 (HSPB1)
   05146 Amoebiasis
    3315 (HSPB1)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    3315 (HSPB1)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    3315 (HSPB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3315 (HSPB1)
  Exosomal proteins of breast cancer cells
   3315 (HSPB1)
  Exosomal proteins of bladder cancer cells
   3315 (HSPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.23
AA seq 205 aa AA seqDB search
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT
IPVTFESRAQLGGPEAAKSDETAAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgccgcgtccccttctcgctcctgcggggccccagctgggaccccttccgc
gactggtacccgcatagccgcctcttcgaccaggccttcgggctgccccggctgccggag
gagtggtcgcagtggttaggcggcagcagctggccaggctacgtgcgccccctgcccccc
gccgccatcgagagccccgcagtggccgcgcccgcctacagccgcgcgctcagccggcaa
ctcagcagcggggtctcggagatccggcacactgcggaccgctggcgcgtgtccctggat
gtcaaccacttcgccccggacgagctgacggtcaagaccaaggatggcgtggtggagatc
accggcaagcacgaggagcggcaggacgagcatggctacatctcccggtgcttcacgcgg
aaatacacgctgccccccggtgtggaccccacccaagtttcctcctccctgtcccctgag
ggcacactgaccgtggaggcccccatgcccaagctagccacgcagtccaacgagatcacc
atcccagtcaccttcgagtcgcgggcccagcttgggggcccagaagctgcaaaatccgat
gagactgccgccaagtaa

DBGET integrated database retrieval system